KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_04435Help
Entry
M634_04435        CDS       T02761                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:900688..901476
Genome map
AA seq 262 aa AA seqDB search
MSVLRRLTLLTLPFFITACGAEESQAKTETPAQQAAPTAQQHFDEAALKAKFSKLGLSII
DIQPSDVAGLLEIQTNGGILFASNNGDHFIAGTLYAIDDNGGYKDVLAERQAPLNAEKIA
KFADSMIEYKADNEKYVVTVFTDITCGYCVRLHNQMQGYNDLGITVRYMAYPRQGATGPV
AEQMATIWCAENPKAAMHNAKVSRTFDNPAKDLEQCKETIQAHYNVGRQLGISGTPAIFL
PNGEMVGGYLPPAELLKRLEQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgactaactctgctgactttaccattctttattaccgcgtgtggt
gcggaagaaagtcaggcaaaaaccgaaactcctgcacaacaggctgcgccaactgcgcaa
caacactttgatgaagcggcgctaaaagcgaagttctcgaaactaggtctgtctattatt
gatattcaaccttcagatgtggcgggcctgctagaaattcaaaccaacggcggcatactg
tttgcgtcaaacaatggcgatcactttattgcaggtacactatacgcgattgatgacaac
ggcggttacaaagacgtacttgcagaacgccaagcgcctttgaatgctgagaaaattgcc
aagtttgcagacagcatgatcgaatacaaagcggacaacgaaaagtacgtggtgacggtg
tttactgacatcacttgtggctactgtgttcgtctacataaccaaatgcagggctacaat
gatctaggtattactgtgcgttacatggcataccctcgccaaggtgcgacagggcctgtt
gctgagcaaatggcaacgatttggtgtgcagaaaatccaaaagcggcgatgcataacgcg
aaagtgagccgcactttcgataatccagcgaaagatcttgagcaatgtaaagagaccatt
caagcgcactacaacgttggtcgtcagttaggtatttcaggtacgcctgcaatcttcctt
ccaaacggtgagatggttggtgggtacttaccgccagctgaactactgaaacgtttagag
caactgtaa

DBGET integrated database retrieval system