KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_05300Help
Entry
M634_05300        CDS       T02761                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpf01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vpf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1093522..1094712
Genome map
AA seq 396 aa AA seqDB search
MIVKTFSLYLFFTSEDIMTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALDRAHMVELARQ
CAELKKQGHSVVMVSSGAIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIY
GIKIGQMLLTRADLDDRERFLNARDTINALVANDIIPIVNENDAVATSEIKVGDNDNLSA
LVGILCGADKLLLLTDQKGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGM
ATKLQAADIARRAGIEVIIAAGSAPNVIFDSLSTEPQGTRFLPCSEALENRKRWILAGPA
ASGDIIIDDGAVNAVVGKGSSLLAKGVIKVSGDFARGEVARVTNSHGKLVARGISAYSSE
DLAKITGKHSKDIISILGHDYGSEVIHRDDLVVIQE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttaaaacattctctctttatttgtttttcacttcagaagacatcatgacaacg
aatcaacaaaacgcagttgtttcgcaaccacaaaccgtcgttgtgaaactgggtacaagt
gtgctgacaggcggcacattggcgctagatcgcgctcacatggttgagctagcgcgtcag
tgtgctgagcttaagaaacaaggccattcagtggtaatggtttcgtctggtgcaattgca
gcaggccgtgagcatcttggataccccgcactgcccaacgagatggcgagcaaacagttg
cttgctgctgtgggtcagagtcgtttgattcaaacatgggagtctttgtttggtatttac
ggtatcaagattggtcaaatgctactgactcgtgctgacttggatgatcgtgagcgtttt
cttaatgcgcgtgacaccatcaatgcgcttgtggcgaacgatattattccaatcgtgaac
gaaaatgatgcagtagccaccagtgaaatcaaagttggcgacaatgacaacctatcggct
ttagtgggtattttgtgtggtgcagataagttattgctactgacagaccaaaaaggcctg
tttactgctgacccacgaaaagatccgaatgcagagctgatcaaagaagttaaaaccatt
gatgacacgttgcgtaaaattgctggcggcagcggtacaacactcggtacgggtggtatg
gcgacgaaacttcaagcagccgacatcgctcgtcgcgcgggtattgaagttattatcgca
gcaggtagcgcgccaaacgtaatttttgactcgttgagcacggaacctcaaggtacgcgt
ttcctaccttgttcagaagcattggaaaaccgtaagcgttggatcctcgcaggtcctgct
gcatcgggtgacattatcatcgatgatggtgcggtaaatgcggttgttggtaaaggcagc
agcctacttgcaaaaggggtcatcaaggtgagcggtgattttgcccgtggtgaagttgct
cgcgtaacaaattctcatggcaaactggttgcgcgtggtattagtgcctactcaagtgaa
gacttggcaaaaattactggcaaacacagtaaagacatcatctctattttgggtcatgac
tacggctcagaagtgattcatcgcgatgatcttgtcgtcattcaagaatag

DBGET integrated database retrieval system