KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_06050Help
Entry
M634_06050        CDS       T02761                                 

Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1232182..1233288
Genome map
AA seq 368 aa AA seqDB search
MKKLISFLMLFVSPYLWANTCEWPHWETFKSVYMEQGRVVDGSDERMITTSEGQSYALFF
ALVANDPKTFDQVLKWTQSHLAGGDLTARLPAWLWGRKENGQFGVLDSNPASDSDLWIAY
SLVEAGRLWNNYYYQTLGHLIASRILREETVNIAGVGTVLLPAPTGFDADGQYRVNPSYV
PLQLIARMQSLYPQYNWDSMYKASVHMLEKTMPAGFSPDWATLRNGRYSSDGVTGPIGSY
NAIRTYLWVGMLNDQVSEKAVLVQKMQPFVAATKTLGAPAREVNTETGKYTQAGSAGFSA
AALPLLAVSGESALLETQFRRAQNELVVDKNDHYYDNVLSLFGLGWHEERYRFGVQGELL
PVWSERCQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcatctcgttccttatgttgttcgtgtctccttacttgtgggctaacacc
tgcgagtggccacattgggaaacatttaagtcggtatacatggagcaaggccgagtcgtt
gatggcagtgatgagcgtatgattacgacctcggaaggtcaatcttacgcattgttcttt
gccttggttgccaatgaccctaaaaccttcgatcaggttttaaaatggactcaatcacat
ttggctggtggggatttgacggcaaggcttcctgcttggttgtggggaagaaaagaaaat
ggtcagttcggagtgttggattctaatccagcgtcagattctgatttgtggatagcgtac
tccctcgttgaggcgggaagattatggaataactactactatcagacccttggacatctt
atcgcgagtcgtattttacgtgaagaaaccgtcaacatagcgggagttggaacggtattg
ttgcctgctccaacaggttttgatgccgacggccagtaccgtgtgaatccgagttatgtt
ccgttacaactgattgctcgtatgcagtctctgtacccgcaatacaactgggattcaatg
tataaggcaagtgttcacatgctagagaaaacgatgccagctggctttagcccagactgg
gcaacattgagaaatggtcgttatagctcagatggggtcactgggccgataggcagttac
aacgcgatccgcacttatctttgggtgggcatgttaaatgaccaagtttcagaaaaagca
gtattagttcaaaaaatgcagccgtttgtggcggcaaccaaaacccttggtgcgccagcg
agagaagtaaatactgaaacgggtaaatatacccaagcaggaagcgcaggtttttctgct
gcggctcttccgttactcgcggtttctggtgaatctgcgctgttggagacgcagtttcgt
cgtgctcaaaatgaacttgtggtggacaaaaacgatcattattacgacaacgtattaagt
ctatttgggcttggttggcatgaagaacgttaccgttttggtgtgcaaggtgaattgctt
cctgtatggagcgagagatgtcagtaa

DBGET integrated database retrieval system