KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_06645Help
Entry
M634_06645        CDS       T02761                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00220  Arginine biosynthesis
vpf00250  Alanine, aspartate and glutamate metabolism
vpf00290  Valine, leucine and isoleucine biosynthesis
vpf01100  Metabolic pathways
vpf01110  Biosynthesis of secondary metabolites
vpf01130  Biosynthesis of antibiotics
vpf01210  2-Oxocarboxylic acid metabolism
vpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M634_06645
   00290 Valine, leucine and isoleucine biosynthesis
    M634_06645
   00220 Arginine biosynthesis
    M634_06645
Enzymes [BR:vpf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M634_06645
    2.6.1.66  valine---pyruvate transaminase
     M634_06645
Amino acid related enzymes [BR:vpf01007]
 Aminotransferase (transaminase)
  Class I
   M634_06645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGQ90465
UniProt: S5IR57
Position
I:complement(1361480..1362694)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGNPVHYLCDEQSDWYPDLDDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAFELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLETAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagttgaacatt
ggtaaccctgccccatttggttttgacgcccctgatgagattcttgtagatgtaattcgt
aatctaccgacctctcaaggctactgtgattccaaaggcatttactctgcacgtaaagcg
gtggttcaacattaccaacgcaaaggcattcgttctttagacgtagaagatgtgtacgtc
ggtaatggcgtgtctgagctgatcgtgatggcaatgcaagcgctgctaaacaacggcgat
gaaatgctcatccctgcgcctgactacccactgtggacggcatcagtagcgttgtctggt
ggcaaccccgttcattatctgtgtgatgaacaatcggattggtatccagaccttgatgac
atcaaaaagaaaatcacgccgaagactcgcggtattgttctgatcaacccgaacaaccca
acaggtgctgtatatagtcgtgacttcttgctagaggtgattgagattgctcgccaacac
aagctgatcattttcgctgacgagatttacgacaaagtgctttacgatggcgcaacacac
acttctgttgcgacgctaacggaagacgtacttgtgatgacctttaatggtttgtcgaaa
gcttaccgtgtatgtggtttccgtggtgggtggatgttcttaactggtccaaaacactta
gcacaaggctacgttaacggtctagagttgctctcttctatgcgtctttgtgccaacgtg
ccgatgcaacatgcgattcaaaccgcgctaggtggctaccaaagtatcaatgagttgatc
ttacctggtggccgattgctagagcagcgtaatcgcgcgttcgagctgatcaaccagatc
ccaggggtatcttgtgtgaaacccaaaggtgccatgtacttattccctaaaatcgatacc
aagatgtacaacatcaagaatgaccaacagatggtgctcgatttcttgaaacaggaaaaa
gtactgctagtacaaggctcaggttttaactggccaaaaccagaccatttccgcattgtg
actttgccacacgttgaagatctggaaaccgcaatcggacgcttcgagcgattcctatca
acctacagccagtaa

DBGET integrated database retrieval system