KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_12860Help
Entry
M634_12860        CDS       T02761                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M634_12860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M634_12860
   00620 Pyruvate metabolism
    M634_12860
   00650 Butanoate metabolism
    M634_12860
  Lipid metabolism
   00071 Fatty acid degradation
    M634_12860
  Amino acid metabolism
   00350 Tyrosine metabolism
    M634_12860
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M634_12860
   00626 Naphthalene degradation
    M634_12860
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M634_12860
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M634_12860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(2671438..2674140)
Genome map
AA seq 900 aa AA seqDB search
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDKIFRAASLAANQARIPLAQQAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEQTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASVLMSKTF
DNGVVCASEQAVIVVDEVYDEVKERFASHKAHVLSKTDADKVRKVLLIDGALNAKIVGQP
ATAIAEMAGVKVPADTKVLIGEGLGKVSYDDAFAHEKLSPTLGMFRADNFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKMKTARILINIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALGDLEGKKR
AFLVTDRFLFNNGYADDVVSLLKAQGMEVQTFFDVEADPTLSVVEKGAAQMASYQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYEITPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGANDPIAREKVHNAATIAGVAFANAFLGV
CHSMAHKLGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKVNLDIPMSIQAAGVAEADFVAKLDELAVEAFDDQC
TGANPRYPLISELKDVLLASYYGKAFVEGETFEGTTVIKKKADQEAAKSAPKAKKEKADA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatatggctgaactagatgcaatgattgctcgcgttaagaaagcgcaa
gaagagttcgctacttactctcaagagcaagtagacaaaatcttccgtgcagcgtctctt
gcagctaaccaagctcgtatccctctagcgcaacaagcggtagaagaatctggtatgggt
attgttgaagataaagtaatcaagaaccacttcgcttctgagtttatctacaacaaatac
aaagacgaacaaacgtgtggcatcctagaagaggatgacaacctaggtactatgactatc
gctgaacctgtaggcatcatctgcggtatcgtaccaacaactaacccgacatctacagcg
atcttcaaatctctaatctctctgaagactcgtaacggtatcatcttctcaccacaccca
cgtgcgaaaaactctactaacgatgcagctaaacttgttctagatgcagcagtagcagca
ggtgcaccaaaagacatcatcggttggatcgaccaaccttcagttgagctatcaaacgct
ctaatgaaacacgatgacatcgcgcttatccttgcaactggtggtccaggcatggttaaa
gccgcttactcttctggtaagccagcaatcggtgtaggtgctggtaacgttcctgtagtt
atcgatgaaacagcagacatcaaacgtgcagttgcttctgtactaatgtctaaaactttc
gataacggcgtagtatgtgcttctgagcaggctgtaatcgtagttgatgaagtttacgac
gaagtaaaagagcgttttgcttctcataaagctcacgttctatctaaaacagatgctgac
aaagtacgtaaagtgcttctaatcgacggcgcgctaaacgcgaaaatcgttggtcaacca
gctacagctatcgctgaaatggcgggtgttaaagttcctgcagatactaaagtgcttatc
ggtgaaggcctaggcaaagtatcttacgatgacgcatttgctcacgagaaactgtctcca
actctaggtatgttccgtgctgacaacttcgaagatgcagttgctcaagcagtaacaatg
gtagagatcggcggtatcggtcacacatctggtctatacactaaccaagacgtgaatgca
gaccgcatccgttacttcggtgacaagatgaagactgctcgtatcctaatcaacatcccg
actacacacggtggtatcggtgacttgtacaacttcaacgttgcaccttctctaactcta
ggttgtggctcatggggtggtaactctatctctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgtagcgaagcgagctgaaaacatgttgtggcataaactacctaagtca
atctacttccgtcgtggtagccttccaatcgcacttggcgatctagaaggtaagaaacgc
gcattcctagtaactgaccgtttcctattcaacaacggttacgcagatgacgtagtaagc
ctactgaaagctcaaggcatggaagttcaaacattcttcgatgttgaagctgacccaaca
ctatctgtagtagaaaaaggtgcggctcaaatggctagctaccaacctgacgttatccta
gcgctaggcggtggttctccaatggatgcagcgaaaatcatgtgggtaatgtacgagcac
ccagaaactcactttgaagaactagcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtaagaaagctgagcttgtatgtatcactacaacttcaggtact
ggttcagaagttactccattcgcagttgttactgacgacaagactggtgctaagtaccca
ctagctgactacgaaatcacgccaaacatggctatcgttgatgcgaacctagtaatgaac
atgcctaagtctctaacagcgttcggtggttacgatgcagtaactcacgctctagaagct
tacgtatctgttcttgcgaacgaatactctgacggtcaggctcttcaagcacttaagatg
ctaaaagaatacctaccatcaagctacgcgaatggtgcaaatgacccaatcgctcgtgag
aaagttcacaacgcagcaactatcgctggtgtagcatttgcgaacgcattcctaggtgtt
tgtcactcaatggcgcacaaactaggtgcagagttccacttgccacacggcctagctaac
gcactactaatctctaacgtggtacgttacaacgcgaacgacaacccaactaaacaaact
gcgttctctcaatacgaccgtccacaagcacgtcgtcgctacgctgaagttgcagaccac
ctaggcctaagccaagctggtgaccgcactgctcagaagattgaacgtctactagcatgg
ttggatgaactaaaagttaacctagacatcccaatgtctatccaagcggcaggtgttgct
gaagctgacttcgtagcgaaactagacgagctagcggttgaagcgttcgatgaccaatgt
actggtgcgaacccacgctaccctctaattagcgagctaaaagacgttctactagcttct
tactacggtaaagctttcgttgaaggtgaaactttcgaaggtactacagtaatcaagaag
aaagcagaccaagaagcagcgaaatctgcgcctaaagctaaaaaagaaaaagctgacgcg
taa

DBGET integrated database retrieval system