KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_14550Help
Entry
M634_14550        CDS       T02761                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vpf00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3020861..3022189)
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEVLTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLEAIPGYNITPTNEVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAENTDDARAKL
MEVLDNGKAAACFSKMVAGLGGPADFVENYDNYLEKAEIIKPVYATETGIVSAMDTRAIG
MAVVSMGGGRRVATDEIDYAVGFDNFIRLGEVADSDKPLAVIHARSEEQWEEAAKALRCA
IKVGGEYTPTPEVYRQIRAEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccacaagaaatcattcgtaaaaaacgtgacggcgaagtcctaacagccgac
gaaatcaacttctttattcaaggcgtagcgaacaacacggtatctgaaggtcagattgcg
gcgtttgctatgacgattttctttaatgaaatgaccatggatgagcgcatcgctctaacg
tgtgcaatgcgtgactcaggcatggtaatcgactggagccacatgaacttcggtggtcca
attgtcgacaaacactcaaccggtggtgtgggtgacgtaacgtctctgatgcttggccct
atggtggcagcatgtggcggtttcgtacctatgatctctggtcgtggccttggccacaca
ggcggcacgctagataaacttgaagcgattcctggttacaacatcacaccaacgaacgaa
gtttttggtcaagtaaccaaagatgcgggtgtggcgatcatcggccaaacaggcgatctt
gctccggcagataagcgtgtgtacgcgactcgtgatatcacggctaccgtagacaacatc
tcactgatcacggcatcgatcctgtctaagaaattggcagcgggtctggaatctctagtg
atggatgtaaaagtcggttctggcgcattcatgccaacttacgaagcgtctgaagagcta
gcaaaatctatcgttgctgtagcgaatggtgcaggcacgaagactaccgcaatccttacg
gacatgaaccaagtactggcttcttctgcgggtaacgcggtggaagttcgtgaagcggtt
cgtttcctaacaggtgaataccgcaacccgcgtctacttgaagtgacgatggcatcatgt
gctgaaatgctcgtgcttggcaaacttgctgagaacacagacgacgcacgcgcgaaactg
atggaagtgctagacaacggtaaagcagcagcttgcttcagcaaaatggttgcgggtctt
ggcggtccagctgacttcgtagaaaactacgacaactacctagaaaaagcagaaatcatc
aagccagtttacgcgacagaaacaggtattgtctctgcaatggacacgcgtgctatcggc
atggctgtggtttctatgggtggcggtcgccgtgttgcaactgatgaaatcgactacgcg
gtaggttttgataacttcatccgattgggtgaagttgctgatagcgataaacctctagca
gttatccacgctcgcagtgaagagcagtgggaagaagcggcaaaagcactacgctgtgca
atcaaagtgggtggtgaatacacgccaactccagaggtttaccgtcaaattcgtgcagaa
gacatctaa

DBGET integrated database retrieval system