KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_14880Help
Entry
M634_14880        CDS       T02761                                 

Definition
peptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M634_14880
Enzymes [BR:vpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     M634_14880
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     M634_14880
Glycosyltransferases [BR:vpf01003]
 Polysaccharide
  Bacterial polysaccharide
   M634_14880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3100448..3102820)
Genome map
AA seq 790 aa AA seqDB search
MTDSKKPSAKKAPAKKSTASKGTTKRPRRTPSKKPTNEKRSWLKVLWSFSWKAGVALAAV
LLFVGIYLDSVVKERFDGQLFELPTVVYARILNLNPGENITIQELRNELDVLNYRKVSQP
RYPGEYSSSSTRVELIRRPFEFADGPEPDRHVMLHFSDSGLQRIQSLESKGDLGYLRLEP
KMLGMLEKDRDEQRLFLRRDQFPEILVDALLATEDRDFYQHDGVSPLAIARALVANIKAG
RTVQGGSTLTQQLAKNLFLTRDKTLWRKVREAYIALILDYRYSKDRILEAYLNEVYLGQS
GGEAIHGFGLASRYYFGQPIQELRIDQLAMLVGMVKGPSYYNPVRYPERTKERRDLVLRL
LMQQNMLTSQQYEQAVSRPLDTQSKPRIASRQPAYFQQLNIELKEKVGDRFKAETGLRVF
TSLDPVSQSKMEQAIAKKIPDLAKRGGKELEAAAVAVDRHSGEIRAMVGGKRVGYEGFNR
ALNASRPIGSLVKPAIYLTALEQPDKYNLGTTLHDTPLSLKGSKGSVWTPRNYDRKYRGD
VPLYLALAKSLNVPTVRLGMELGIPEVSGTLERLGVNKDEIRPVPSMFLGSFSLTPFEVA
QMYQTLTNSGKRAKLTALRSVIDMDGNVLYQSLPRSSRAVDEQAAWLTTYAMKQGVAQGT
GRYLQSQFAWAALAGKTGTSNDTRDSWFVGIDGREVTTIWLGRDDNKPINLTGSSGALRV
YAEYLAQRIPERLELPWPKEVTTLGFKPTSNGGLEMNCRSDYKLPVWDKTGQIKQQCEKK
SNWLNSLFDW
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgactgacagtaagaagccaagcgctaagaaagcgcctgcgaagaaaagtacagccagc
aaaggtaccacaaaacgccctcgtcgcacgccgagtaaaaagccaaccaacgagaaacgt
tcttggctcaaagtgttgtggtctttcagctggaaggccggcgttgctcttgccgcggtg
ttgctgtttgttggtatttacctagatagtgtggttaaagaacgctttgatgggcagcta
ttcgaattacctaccgttgtgtacgcgcgcattttgaacctcaatccaggtgaaaatatt
accattcaagagcttcgcaacgaattagatgtactgaactaccgcaaggtaagtcagcct
cgttaccctggtgagtattcttcttcttcgactcgtgttgaactgatccgccgtcctttt
gaatttgctgatggcccagaaccggatcgccacgtcatgctgcatttctcagacagcggt
ttgcagcgtattcaatctttagaatcaaaaggcgatctgggctacttgcgccttgagcca
aagatgctggggatgcttgaaaaagatcgtgatgagcaacgtctgttcttacgtcgtgac
caattccctgaaattttagttgatgccttgttggcgacagaagaccgagacttctatcag
catgatggtgtttcaccattggctattgctcgtgctttagtggcgaacatcaaagcgggt
cgcaccgtgcaaggtggcagtaccttaacgcagcagctagcgaaaaacttatttctaacc
cgtgataaaacgctgtggcgtaaggtccgcgaagcttatattgcgcttattcttgattac
cgttatagcaaagaccgcattttagaagcctacctcaatgaagtgtatttgggccaaagc
ggcggcgaagcgatccacggttttggcttagcatcacgctactactttgggcagccaatc
caagagttgcgaattgatcaacttgcgatgctggtgggcatggtgaaaggaccgtcgtac
tacaatccagttcgctatcctgagcgcactaaagagcgtcgagacttggtgcttcgattg
ctgatgcaacaaaacatgctcacatcgcagcaatatgaacaagctgtgagtcgacctctt
gatacacaaagcaaaccacgtattgcgagccgtcagcctgcatacttccagcaattgaat
atcgagctgaaagagaaggtcggtgatcgcttcaaggctgaaactggtctgcgcgtgttt
acgtctcttgatcctgtctctcaaagtaaaatggagcaggcgatcgcgaagaaaataccg
gatttagcgaagcgaggcggcaaagagcttgaagctgctgccgtggctgttgatcgccac
agtggtgaaattcgtgccatggttggtggtaaacgcgtgggttatgaaggctttaaccgt
gcgcttaatgctagtcgtccaattggttcgttggtcaagccggcgatttacctgaccgcg
cttgaacagccagacaaatacaatttggggacgacgctgcacgacacgcctctaagtttg
aaaggtagcaaaggctcggtgtggactccgcgtaactacgaccgtaaatatcgtggtgat
gtgccactttaccttgcgcttgcgaagtcattgaacgtaccaacggtaaggttggggatg
gagcttggtattccagaagtgtctggcacgcttgaacgtttaggcgtcaacaaagatgag
attcgtcctgtgccttctatgttcttgggctcgttttcattgacgccatttgaagtggcg
caaatgtaccaaactctgactaactcgggtaaacgcgctaagctgaccgcgcttcgttcc
gtcatcgatatggacggtaacgtgctttatcaatcgttgcctcgttcctctcgcgcggtt
gatgaacaagcggcttggctaacgacttacgcgatgaaacaaggtgtcgcacaaggtacg
ggccgctaccttcaaagccaattcgcttgggctgcattggcgggtaaaacgggcaccagt
aacgatactcgtgatagctggtttgtcgggattgatggccgtgaagtgacgaccatttgg
ctaggccgtgatgataacaagccaatcaaccttacggggtcaagcggtgcattgcgtgtt
tacgcggaatacttggcgcagcgaattcctgagcgtttggagttgccttggcctaaagaa
gtgacgacgcttggctttaaaccgacctccaacggtggtttagagatgaattgccgcagc
gattacaaacttccagtatgggataaaacgggtcaaatcaaacaacagtgtgagaaaaaa
tctaactggttgaatagtttgtttgattggtag

DBGET integrated database retrieval system