KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_15530Help
Entry
M634_15530        CDS       T02761                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00220  Arginine biosynthesis
vpf00250  Alanine, aspartate and glutamate metabolism
vpf00471  D-Glutamine and D-glutamate metabolism
vpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M634_15530
   00220 Arginine biosynthesis
    M634_15530
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M634_15530
Enzymes [BR:vpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     M634_15530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGQ91767
UniProt: S5INN4
Position
I:complement(3229001..3229921)
Genome map
AA seq 306 aa AA seqDB search
MKPTAEILTDILAEVRPLIGQGKVADYIPALAKVPNNKLAIAVYTNEGEVIKAGDADESF
SIQSISKALSLTLAMCLYKQEEIWARVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIV
VADLLQSRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFE
NEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPTQTKQLNALLATCG
LYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAVWSPELDASGNSLAGTKALELLSER
IGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgacagcggaaattttgacagatattctggcggaagtgcgccctttgatcggc
caaggaaaagtggcggactacattccggctctggcaaaagtaccgaataataaattagct
attgcggtgtacaccaatgaaggtgaagtgattaaggctggcgatgccgatgagtctttt
tctattcagtctatttcgaaagcactgagcctaacgttggccatgtgcttgtacaaacaa
gaagaaatttgggcaagagttggtaaagagccatcaggtcaggcgtttaactcgctgatt
cagttggagatggaacagggtattccacgcaacccgtttattaacgcgggtgcaattgtt
gtggctgacttgttgcaaagtcgtttgtctgcacctcgtcagcgcttacttgagtttgtc
cgtcagttgtcgggcgatactcacattgtctacgacaaagtcgtggccgcgtcggaaatg
atgcacggtgatcgcaacgcggcgattgcttacctaatgcgttcattcgggaacttcgaa
aacgaggttattcctgtgctgcaaaactacttccatgcctgtgctttaaagatgagctgt
gtggacttagcaaaaacctttagctacctagccaacaaaggcacttccgtgcaaacgggc
aagccagtggtgtcaccaacacaaacgaagcaactgaatgcattgctagcaacttgtggt
ttgtacgatggtgccggtgagtttgcttaccgtgtgggtatgccgggtaaatctggcgtc
ggtggcggcattattgccgtggttccgggtgaaatgaccattgcggtttggtctccagaa
cttgatgcgtcagggaactcgctggcgggtacgaaagcactggaactgctctctgagcga
attggtcgttcgattttctag

DBGET integrated database retrieval system