KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_17540Help
Entry
M634_17540        CDS       T02761                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M634_17540
Enzymes [BR:vpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M634_17540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(289566..291626)
Genome map
AA seq 686 aa AA seqDB search
MKLNLITTTLLLVSASAIAEPNITISTTTNSRDFPLSVEQPLVVPLTKDGYTLKITGVEG
DCVAPDGQKVKFNKPIALNCGKPTELPLKVRFTGDYSFAYDDVVKTLLFKREPKKAAKTE
FKRPIPQVQCEVYQGGEVTIALGDSFPEGTKLRDAYSGQMVEVKEQKVSLTPSKDSGGLV
LLEPVQKTKEAVPFDYRNANIYFVMVDRFNNADASNDNSYGRKKDGKDEVGTFHGGDLKG
VIEKLDYIKSLGTDAIWLSPIVEQVHGFVGGGDSGSFPFYAYHGYWTRDFTKIDENFGNE
EDLKTLVEEAHKRGLKVLMDAVINHSGYSTLADLQFDGIDVLKPNAELPKKWGDWQPKAG
ENWHSYHQNIDYQSPNWAKWWGGDWVRTGLPGYPAPGSSDITMSLAGLPDFITESDKAVK
PAQWLLDNPGTRVEARDNYTVSDYLIEWQTDWVKRFGIDGYRVDTVKHVEGEVWKRLKEE
ASNSLEQWRKENGKSGQPFWMMGEVWGHTAYRSPYFDDGFDALINFDMQKKLDKGAACFS
QMADTYQSYADTIANEKDFNPVSYMSSHDTELFFSRFKDYGMQRNAANALLLSPGAVQVY
YGDEVGRNIGPYADDFHQGTRSDMVWKLSDDKQALLKHWQTLGQFRQAHPAIGAGQHQVI
EQEGAYVFSRLLGNDKVVVAFVGRDK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaacctgattaccactactttactgcttgtgtcggcaagtgccatcgccgag
cctaacatcaccatttctaccacgaccaacagccgtgactttcctttaagtgtagagcag
cctttggttgtgcccttaaccaaagatggatacacgctcaaaatcacgggtgttgaaggc
gactgcgttgcacccgatggtcagaaagtgaagttcaacaaacctatcgcgctaaattgt
ggcaagccgaccgaactgccactcaaagttcgctttactggtgactattccttcgcttat
gacgatgtggttaagacgttgctgtttaagcgagagccgaaaaaagcagcaaaaaccgaa
tttaaacgcccgatcccgcaagtgcaatgtgaggtttaccaaggcggagaagtgacgatc
gctctgggggatagctttcctgaaggcaccaagctacgcgatgcttattcaggtcaaatg
gttgaagtgaaagagcagaaagtatcactgacgccaagtaaagactctggcggcctagtg
ctgctagagcctgtgcagaaaaccaaagaagcggtgccatttgattaccgaaacgcgaac
atttacttcgtgatggttgaccgtttcaacaacgcagacgcaagtaacgacaacagttat
ggtcgtaaaaaagacggcaaagatgaagttggcacgttccacggcggtgaccttaaaggt
gtaattgagaaactggattacatcaagagcctaggtacagacgcgatttggttgtcgcca
atcgttgaacaagtgcacggctttgtcggtggtggcgatagtggctcattcccgttttat
gcttaccacggctactggacgcgcgatttcaccaagattgatgagaacttcggtaacgaa
gaagatttaaaaacgctggtggaagaggcgcacaaacgtggcctcaaagtcttgatggat
gcggttatcaaccattctggttactcaacattggcggatctacagtttgatggtatcgat
gtgttaaagcctaatgccgaactgcccaagaaatggggcgactggcaaccaaaagcaggc
gaaaattggcatagctaccaccagaatattgattatcagagtccgaactgggcgaagtgg
tggggcggcgattgggtaagaaccggcttgccgggttacccagctccgggcagtagcgac
attacgatgtctcttgctggcttgccagatttcatcactgaatcagacaaagcagtgaag
cccgcgcagtggctattggataaccctggtactcgcgttgaggcgcgtgacaattacacc
gtctcggactacctaattgagtggcaaactgattgggtgaaacgcttcggcattgatggt
tatcgcgtcgacacggtgaaacacgtcgaaggtgaagtttggaagcgtctaaaagaggaa
gcatcgaacagcctagaacagtggcgtaaagaaaatggcaaatcaggtcagccgttctgg
atgatgggcgaagtctggggacacaccgcgtatcgcagcccttatttcgatgatggtttt
gacgcgttgatcaacttcgatatgcagaagaagctagacaaaggcgcggcgtgctttagc
caaatggcagacacttaccaaagctatgcggacactatcgcgaacgagaaagacttcaac
ccagtcagttacatgtcttctcacgatacggagttgttcttctcacgttttaaagattac
ggcatgcaacgtaacgcggcgaacgcattgcttcttagtccaggcgcggttcaggtttat
tatggtgatgaagtaggtcgtaacattggcccttacgcggatgatttccaccaaggcaca
cgttcagacatggtttggaagctatctgatgacaaacaagctttgctgaaacactggcaa
acccttggtcagttccgtcaagcacaccctgccattggcgcaggtcagcatcaagtgatt
gaacaggaaggcgcgtacgttttctcccgtttgcttggcaatgacaaagtcgtcgtggcg
tttgtaggacgtgataagtaa

DBGET integrated database retrieval system