KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_17550Help
Entry
M634_17550        CDS       T02761                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M634_17550
Enzymes [BR:vpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     M634_17550
Exosome [BR:vpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M634_17550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(292636..294831)
Genome map
AA seq 731 aa AA seqDB search
MKITKTKKIKKKHERAYELLAEAAYSDPFAALGPFIDDGEGSLRVWMPGANKVELLVNGE
PRVALERDGDSGFILKEQRDLHLTHYRLAVDWNGVEQIIDDPYQYHNIYQEYEHLHTPKD
MYHYMGAHFVTLERGGENISGVRFLVYAPHASALSLVGCFNQWDGRRHPMQRLDYGIWGL
FIPGLEEGVQYKFELKGPNGEGLPHKQDPWGFYSEQYPSFASITYDHKRYQWQDAKWQNR
AVTQKRDEALSFYELHAGSWKRDGKGDFLNYRELAEQLVPYLVDMGYTHVELMPVSEHPF
YGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFPSDDHGLANFDGT
PLFHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNALYWFEQFHIDGIRVDAVASMLYLD
YSRSHDQWVPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGG
LGFGFKWNMGWMHDSLSYIKEDPVHRKYHHNTITFPLVYAHSENYVLSLSHDEVVYGKGS
IHNKMPGDEWQQTANLRAYYGYMYGQPGKKLNFMGAEIGQTAEWNHDDQLQWFLLEYERH
QGVQKLMRDLNHLYRNEAAMHDQDCVPAGFEWRLQDEADASILAHERISQKGERILIITN
FTPVPHERFRLGVPNAGQYELLLNTDGSKYGGSDFKVLTSVKTEKVESESLPQSLELRLP
PLSTVFYKLNK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcaccaaaacaaagaaaataaagaaaaaacacgaacgcgcgtacgaactgctt
gctgaggcggcttactcagatccatttgcggcgttgggcccattcattgatgacggcgaa
ggttcgctgcgagtgtggatgccgggcgcaaacaaggttgaactgcttgttaatggtgaa
cctcgcgtggcgcttgaacgcgatggcgacagcggttttatcttaaaagagcaacgcgat
ttacacctgacccactaccgtttagcggtcgattggaatggtgttgaacaaattattgat
gacccgtaccagtaccacaatatctaccaagagtacgagcatctgcatacgccaaaagac
atgtatcactacatgggcgcgcactttgtcacgctagaacgtggcggtgaaaacatttcc
ggtgttcgtttccttgtctacgctccgcatgcatcggctcttagccttgtgggttgcttc
aaccaatgggatggtcgtcgtcacccaatgcaacgtttagattatggcatttggggtttg
ttcattcctggcttagaagaaggcgttcagtacaaatttgagctcaaagggccaaatggg
gaagggctaccacacaaacaagacccttggggtttctactctgagcaatacccatcgttc
gcatccattacttacgatcacaagcgttaccaatggcaagatgcgaaatggcaaaaccgc
gcagttacacaaaagcgtgatgaagcgttatcgttttatgagctgcatgctggatcatgg
aagcgcgacgggaaaggtgatttcctcaactaccgcgaactcgcggagcagttggtgcca
taccttgtggatatgggctacacccacgttgagctgatgcctgtgtctgagcatccattc
tatggttcatggggctatcaacccgttggcttatttgcgccaaccagccgttacggttct
cctgatgatttcaaattcttcgtggatgcgtgtcaccaagctggtatcggtgtggtgctg
gattgggttccggcacatttcccatcggatgaccacggtttagcaaactttgacggcaca
ccgctgttccacgacccggacccacgtcgcggttggcaccaagattggaactcatacatc
tatgatttaggccgtgaacatgtgcgtcgcttccttgtatcgaatgcgctgtactggttt
gaacaattccatattgatggcattcgcgtggacgcagtcgcatcgatgctctatctcgat
tattcacgtagtcacgaccagtgggtaccaaacgtcgacggtggcaacgaaaactacgac
gcaatcgcaaccttaaaatggatgaacgaagaagtgtacaagcacttcccgaatgcgatg
acgattgcggaagagtcaacggcgtttccgggggtgtctgcgccaacctttatgggtggt
ttaggttttggcttcaagtggaatatggggtggatgcacgacagtctttcatacatcaaa
gaagatcctgttcaccgcaaataccaccacaataccatcacattcccgctggtttatgcg
cacagcgagaactacgtcttgtctctctctcacgatgaggtggtgtacggcaaaggctct
atccataacaagatgccgggtgatgaatggcagcaaaccgcaaacctacgtgcatactac
ggttacatgtatggtcaaccgggcaaaaagctgaacttcatgggcgcggaaatcggccaa
acggcggagtggaaccacgatgatcagttgcaatggttcttgctggaatatgagcgtcat
caaggtgtccaaaagctgatgcgagatttgaaccatttgtaccgaaatgaagcggcgatg
cacgatcaagattgtgttcctgctggttttgagtggcgtctacaagacgaagcggatgcg
agtatcctagcgcacgagcgtatcagtcaaaaaggtgagcgtattctgataatcaccaac
tttacgcccgtaccacacgagcgtttccgtttaggcgttccaaatgcaggtcaatacgaa
ctgctgctgaacacggacggcagcaaatacggcggcagcgattttaaagtgctgaccagt
gtgaaaacggaaaaagtcgaaagtgaatcactgccacaatcacttgagcttcgtttacca
ccactttcaaccgtgttctacaagctgaataaataa

DBGET integrated database retrieval system