KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_17555Help
Entry
M634_17555        CDS       T02761                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M634_17555
Enzymes [BR:vpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     M634_17555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(295099..297279)
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEAKVSDETLRRLLTSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACFKQEDLNQHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVSSVPEFALSAEAQQRVGSAEFQQRLQKARDSHWVNYTEVSQLKMSVLPLLFSEFK
ARHLDKNTDRARAFLDFVEKGGESLLHQAAFDALHADLHAEDSGVWGWPVFPEKYRTFDA
AGTQKYIKDNQDRVHLYMYLQWIADDQIKEAQALAEEKGMAVGLYRDLAVGVADSGSETW
ADEGNLVLDASIGAPPDILGPLGQNWGLPPLNPQVLEATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEKQLEGLFADRLKCKQGILDSVRWHGYLPEGIGHDAQFVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRISKRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcggaaatggcgagattggctgatagctat
gtcagcgcgtggggagacgaggcaaaagtttctgacgagactctacgccgcttgctcact
tcactaggctacgatactagcagcgatgaaaaactattggcttctgctgaaaagaaacat
aagaaagacgtactagcccctgttcttgttttacgcgacggcgaaccagtcgaagtggaa
ctaaacctaggtacgagtgctcgtgagagtgaattcagctggcgtttagaaacagaacaa
ggagaggtacttgaaggctatcttcagtctcaaattgttcgtgatgagcgtgctgagggt
ggccctctagtgtttgcattgccaaagaacttggcatggggttaccacaaactgatcatc
agtcgcaagcgtcgtaaaacgccttacgagatgtcattgatcatcacaccgaaagcgtgt
ttcaaacaagaagacctaaaccaacacaaaaaactgtggggtccaagcattcagctttac
acactgcgtactcagcataactggggcatcggtgattttggtgacctaaaacagttggtg
agtgacattgcctctcgtggtggtgatttcattggtttgaacccgattcactcacttttc
ccagcaaacccagaaggcgcgagcccatacagcccatcttctcgtcgctggctgaacatc
atgtacatcgacgtaagctctgtacctgagtttgcgctaagtgcagaagcacaacagcga
gtgggcagcgcagagtttcaacaacgtctacaaaaagcgcgtgactcgcattgggtgaac
tacaccgaagtttctcaactaaaaatgagcgtattgccgctgctgtttagtgagttcaag
gctcgtcatctcgataaaaacacggaccgcgctcgcgcattcttagatttcgtagagaag
ggcggcgaaagtttattgcaccaagcggcatttgatgcgcttcatgcagatttgcatgct
gaagattctggcgtttggggttggcctgtattccctgagaaataccgcacattcgacgcg
gctggcactcagaaatacatcaaagacaaccaagatcgcgttcacttgtacatgtaccta
caatggatcgcagacgatcaaatcaaagaagcgcaagctctagcagaagaaaaaggcatg
gctgtgggtctgtaccgcgaccttgctgtaggtgttgctgattctggcagtgagacatgg
gcggatgaaggcaacctagtgctggatgcaagcatcggtgcgccaccagatattcttggt
cctctaggtcaaaactggggtctgccaccgcttaaccctcaagtgttggaagcgacaggc
tacgatgcgtacatcaagttgctacgtgccaacatgaagcattgtggtgcactgcgtatc
gaccacgtacttggcctattgcgtctatggtggattccaaaaggcgagaaagcgacagaa
ggtgcgtacttgtactacccagtggaagacatgctcgcaatcctagcgcttgagtcgcac
cgtcatcagtgctctgtgattggtgaagacttaggtactgtaccagatgaaatcgttgat
attctacgtgatgcgggcgtgcattcgtacaaagtcttcttcttcgaaacctcaaaagag
gacggcggctttatttctccgaagcattacgcagagcagtctatggcggcattgtgtacg
cacgacatgccaaccctacgcggtttctggcactgtgatgatttgaaaatgggtcgtgag
attggtctgtacccagatgaaaaacagttggaaggcttattcgctgaccgcttgaagtgc
aaacaaggcatcctagacagcgttcgttggcacggttacttaccagaaggcattggccat
gatgcgcagttcgtaccaatggattcatacctaagcgaagcgcttcaattgcacgttgcg
gcgggtgattctgcactgcttagcgttcagcttgaagactggctagaaatggatcaaccg
gtcaacattcctggcacggttgatgagtatccaaactggcgtcgtaagctgtcgatgaac
ctagatgaaatcttcagtcgtgaagacgtgaatcgcatttctaaacgccttacagaagtt
cgcgcacaggcgagcaaataa

DBGET integrated database retrieval system