KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_19690Help
Entry
M634_19690        CDS       T02761                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M634_19690
  Amino acid metabolism
   00380 Tryptophan metabolism
    M634_19690
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     M634_19690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:766559..768100
Genome map
AA seq 513 aa AA seqDB search
MVSTHWRATMQMSKSFLLITVGLASTSLQAQTLTRDNGAPVGDNQNSITAGENGSVLLQD
VHLIQKLQRFARERIPERVVHARGTGAHGEFVASGDFSDLTLSAPFTEKGKVTPVFVRFS
TVIHSKGSPETLRDPRGFATKFYTEQGNWDLVGNNLPVFFIRDSIKFPDMVHSLKPSPVN
NVQDPNRFFDFFSHEPSATHMLTWVYSNLGTPASYRTMDGFGVHAYKWINQQGDVNYVKF
QWKSQQGIKSLRPNEVTEMQGKDFNHLTNDLYAEIGRGNYPKWDLYVKVLSPEALSKLDY
NGLDATKVWLNVPDRKVGTMTLNRLPENFFLDTEQSAFAPSNLIPGIEPSEDRLLQGRLF
AYADTQLYRLGANLFQLPVNRPLTSVNNHNQNGLSNNAQLSNGDVNYEPSRKLNLAEDNQ
FKAVETKLVGTVQQKAISKPRDFYQAGVLYRSMNEQDRSDLIANLAGDLNKVMDKDIKAT
MVSYFYRADKEYGSRLAEATDTNLSQVKNKAMM
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggttagcacgcattggagagcaaccatgcagatgtcaaaaagctttttattaattaca
gttggcttagccagcacatctctacaggcgcaaaccctgacaagagataacggtgcacca
gtcggtgacaaccaaaattcaatcacagcaggtgaaaacggcagcgtattgctgcaagac
gttcatctgatccaaaaattgcaacgttttgccagagagcgtattcctgagcgagttgta
cacgctcgtggcacgggtgcgcacggtgaatttgttgcgtctggcgattttagtgattta
acgctatccgctcctttcactgaaaagggaaaggtgactcctgttttcgttcgtttttca
accgttattcactcaaaaggatcgccagagacacttcgcgatcctcgtggtttcgccact
aaattttatactgaacagggcaactgggatctggtagggaacaacctgcctgtgttcttt
atccgcgattcaattaagtttccggatatggtgcactctctaaaaccgtctccagtgaac
aatgttcaggatccaaaccgattctttgacttttttagccatgaaccaagtgcgactcac
atgctgacttgggtgtacagcaatcttggcacgccagcgagctatcgcacaatggatggc
tttggcgttcacgcttacaagtggatcaaccaacaaggtgatgtgaactatgtgaagttc
caatggaagagccaacaaggcattaagagtcttcgtcctaatgaagtgacggaaatgcag
ggtaaagacttcaatcaccttacgaatgatttgtatgccgaaattggtcgcggaaactac
cctaagtgggatctgtacgtgaaggtgttgtcgccagaagcgttaagcaagttagattac
aacggccttgatgcaaccaaagtgtggttgaatgtaccggatcgcaaagtgggcaccatg
acgcttaatcgtctgccggaaaacttctttttagacaccgaacagtcggcattcgcacct
tcaaacctgatcccaggtattgagccatcggaagaccgtttgttgcaaggccgtttgttt
gcgtacgctgacactcagctttaccgcttaggcgcgaacttgttccagctgccagtgaac
cgtccgttaacgtctgttaataaccataatcaaaatggtttgagcaataacgcgcagctg
agcaatggggacgtaaattatgaaccaagccgcaagcttaacttggctgaagacaatcag
tttaaagcggtagaaaccaagctcgtaggtacggttcagcaaaaagcgatcagtaaacca
cgagatttctaccaagctggcgtgttgtaccgcagcatgaatgaacaagacagaagcgat
ctgattgctaacctagcgggcgacctgaataaggtaatggataaagacatcaaagcgacg
atggtgagctatttctatcgtgcagacaaagaatacggttcgcgtcttgctgaagcgacc
gataccaatctctcgcaagtgaaaaacaaagcgatgatgtaa

DBGET integrated database retrieval system