KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_21125Help
Entry
M634_21125        CDS       T02761                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vpf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M634_21125
Enzymes [BR:vpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     M634_21125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1073623..1074540
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRENFKMDGIDITGVKMQPNCPTGIAMIQVSDSGENSICISAEANAKLTSE
AIEPDLERIRQADYLLMQLETPMCGIEKAARVAKDAKTNVILNPAPARELSDELLACIDV
ITPNETEAEVLTGVTVTDNESAQEAANVLHGKGIEIVMITLGAKGVWLSQNGRGEIIPGF
RVEATDTTAAGDTFNGAFVTGLLEDLPLESAIKFAHAAAAISVTRFGAQTSIPTREEVDA
FLAEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgccctggcgagacgctgcatggtcgcaactatcaagttatcccaggtggcaaa
ggtgccaaccaagccgtcgcggcggcgcgattaaatgcagatattggttttattgcttgt
gtaggcgatgactctttcggcatcaacattcgtgaaaacttcaaaatggacggcatcgat
atcacaggtgttaagatgcaaccaaactgcccgacaggcatcgcgatgattcaagtgtcg
gacagtggtgaaaacagcatttgtatatcagcagaagcgaacgccaaactgacatcagaa
gcgattgagccagatttagagcgtattcgccaagcggattacttgctaatgcaattggaa
acgccgatgtgcggcattgagaaagccgcgcgtgtggcgaaagatgcaaaaaccaacgta
attttaaacccagccccagctcgtgaattgtcagatgaactgcttgcttgtattgacgtg
atcacgccaaatgaaacggaagctgaagtgctgacaggtgttactgtaacagacaacgaa
agcgcgcaagaagcggcgaatgtgttacatggtaaaggtattgaaattgtcatgatcact
ctcggtgcaaaaggcgtttggttgagccaaaatggtcgaggtgaaatcatccccggtttc
cgtgtcgaagcgaccgataccaccgcggcaggagatacgtttaatggggcattcgtcact
ggtctcttagaagatttacctttagaatcagcgattaagtttgcacatgcggcggctgca
atttctgtgacccgctttggcgcgcaaacgtcgatcccaactcgcgaagaggtggacgcg
tttctcgctgaacaataa

DBGET integrated database retrieval system