KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_0018Help
Entry
VPUCM_0018        CDS       T03116                                 

Definition
(GenBank) Periplasmic alpha-amylase (EC:3.2.1.1)
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VPUCM_0018
Enzymes [BR:vph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VPUCM_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:complement(17080..19164)
Genome map
AA seq 694 aa AA seqDB search
MKKTILALSIGLLSACSQIPENAIVLSVGDDTAVFEPNSDGLLVAEQKLEKGNYTFTIAD
SKQTCGNSFALAEESRIKFNTPLKMDNCATDTSMPLRIFKANTYLFTLNPDTNELTVKIK
PKQSQDITYSCPVATDTAKTINVAQTFTDGTVVRDALTGQEATVANGSVTMQPGPMSQGL
LLLEEVEQQAEKPFSWDNATVYFVMTDRFYNGNPDNDNSYGRSKDGKYEIGTFHGGDLAG
LTKKLDYIESLGVNAIWITSPLEQIHGWVGGGDKGDFKHYGYHGYYHQDWTKLDANMGTE
DELRTFVDTAHKKGIRVIWDVVMNHTGYATLADMQEFGFGQLYLDDQESKQVLGEKWTDW
QPKSGQSWHSFNDYIKYGDSEAWEKWWGKDWIRTDIGDYDAPGYNDITMSLNYLPDLKTE
STQKTGLPNFFRNKNTNAQDELKTPREHLITWLSDWVRDYGIDGFRVDTAKHVEMEAWAE
LKASTTQALAEWKQNHPDKALDDLPFWMTGEVWAHSVVKSPYFDNGFDSIINFEFQSDVA
PKALKCFAQLDNDYRRYAERINSDPEFNVLSYLSSHDTQLFWSARSRSFDDQARAANALM
LAPGAVQIYYGDEIARDFGVTGSDPTQGTRSDMPWDKIHGEREDLLQHWQKLGEFRQRHP
AVAQGKHITRNQEGYYAFERQYQDDKVLIVYTGE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaattctcgcactctctatcggcctactgagcgcctgcagccaaattcca
gaaaatgccatcgtattaagcgttggagacgatactgccgtcttcgaaccaaactcagac
ggtttactcgtcgcagagcaaaaactagaaaaaggcaactacacctttaccattgccgac
agcaaacaaacctgtggcaacagctttgcgctagcggaagaaagtcgcatcaaattcaat
acaccattaaaaatggataactgtgcaacagacacatctatgccgctgcgcattttcaaa
gccaatacctacctcttcacgctcaatccagacaccaatgagctaaccgttaaaatcaaa
ccaaaacaaagtcaggacatcacctattcttgccctgttgcaaccgacacagctaaaacc
atcaacgtagcccaaacctttactgatggcactgttgttcgtgacgccttaaccgggcaa
gaagccaccgtcgccaatggcagcgtaaccatgcaaccaggcccgatgagccaaggtcta
ttgctgttagaagaggttgaacagcaagccgagaaaccgttcagctgggacaacgcaacg
gtgtattttgtcatgactgaccgcttctataacggcaacccggacaacgacaacagctac
ggtcgcagcaaagacggaaaatacgagattggtaccttccacggtggtgacttagcaggc
ctgacgaaaaaactcgattacatcgaatccctcggtgtgaatgccatctggataacctca
ccactggaacaaatccacggctgggttggcggcggcgataaaggcgactttaaacactac
ggctatcacggctactaccaccaagattggaccaagcttgatgccaacatgggtaccgaa
gatgagctgagaaccttcgtcgataccgcccacaagaaaggcatccgcgtgatttgggat
gtggtcatgaaccacactggctacgccacattagccgacatgcaggaattcggctttggt
caactttaccttgatgaccaagaatccaaacaagtacttggtgaaaaatggaccgactgg
cagccaaaatcaggacaaagctggcacagcttcaacgactacatcaaatacggtgatagt
gaagcgtgggaaaaatggtggggcaaagattggattcgcaccgacattggcgattacgat
gcgccgggatacaacgacatcaccatgtctttgaactacctaccggatctcaaaaccgaa
tcgacgcagaaaaccggactaccaaacttcttccgcaataaaaacaccaatgcgcaagat
gagttgaaaaccccacgagaacatctgatcacatggctatcggattgggtacgtgattac
ggcattgatggcttccgcgtcgataccgccaaacacgttgagatggaagcgtgggcagag
ctcaaagcaagtaccactcaagccctcgccgaatggaaacaaaaccaccccgacaaagca
ctagacgatctgccattttggatgaccggcgaagtgtgggcacacagcgtggtgaagagc
ccgtatttcgataacggcttcgattcgatcatcaacttcgagttccaatctgacgtggct
ccaaaagcgctaaagtgtttcgctcaacttgataatgattaccgccgctatgcagagcgt
attaactccgatcctgaattcaacgtgttgagttacctgtcttcgcacgatacacagctg
ttttggtcagcacgcagccgcagctttgatgaccaagctcgcgccgccaatgcgttaatg
ctggcaccgggtgcagtacaaatctactacggcgatgagattgctcgtgactttggcgtg
actggatccgatccgacccaaggtacacgttccgacatgccatgggacaagattcatggc
gagcgtgaagacttactacaacattggcagaaattgggcgaattccgtcaacgccaccca
gcggttgctcaaggtaagcacatcactcgtaatcaagaaggctactacgcgttcgaacgc
caataccaagacgacaaagtactgattgtttacactggcgaataa

DBGET integrated database retrieval system