KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_2251Help
Entry
VPUCM_2251        CDS       T03116                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VPUCM_2251
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VPUCM_2251
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VPUCM_2251
Enzymes [BR:vph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     VPUCM_2251
Exosome [BR:vph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPUCM_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:2431476..2433053
Genome map
AA seq 525 aa AA seqDB search
MKRLVSPIITAVAASTLSFNALSAEIKNVILMIGDGMGPQQVGLLETYANHAPNSIYKGQ
TTALYKLAQEGVIGSSLTNPEDAIVVDSACSATMLATGIPTASEVIGIDSQGNHVETILE
KAKSKGKATGLVSDTRMTHATPAAFAAHQPHRSLENNIASDMLESGVDVLLSGGLRHWIP
KSTNDKGETYQAIEKLTQGSVYLKSKRKDERNLLTEAQDQGYSLAFSRDMLAQAKGDKLL
GLFAYSGMDDGIAYSNSKNDPKRTQPSLKEMTVKALDVLSKDKDGFFLMVEGGQIDWAGH
SNDAGTMLHELIKFDEAVNSVYEWAKGRDDTLIIVTADHETGSFGFSYSSANLPKPEKRK
GEAFEKRDYAPNFNFGKFEILDGLYNQKKSYYGMISEFEALDKAQQTPEKLAEVVNTNSD
FPITPEQAAHVLASKPNPYRVAGHSYLEVETVPTINDFDAFFPYNDRGNLLAREQATKQN
TVWGTGTHTHTPVNVFAWGPAETILPVSKIMHHSELGEFLKQQIK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtttagtttctccgattattactgcagtggctgcatctacactttcattcaat
gcgctatccgctgaaatcaaaaacgttattctgatgattggtgatggtatgggtcctcag
caagtcggcttgctagaaacctacgcgaaccacgcaccaaactcgatttacaaaggccaa
accaccgcgctctacaagttagcgcaagaaggtgtgattggctcatctttaacgaaccca
gaagatgcgatcgttgtcgactctgcatgttcggcaacaatgctcgcaacaggtatccca
actgcatcagaagtgattggtattgacagccaaggcaatcacgttgagaccattttggaa
aaagccaaaagcaaaggcaaagcaacgggtcttgtttcagatacgcgcatgacgcacgca
acaccagccgcgtttgctgcgcatcagcctcatcgatcgctagaaaacaacatcgcttcc
gatatgctagaaagcggtgtcgacgtgttgttatctggtggtcttcgtcactggattcca
aaatcgactaacgacaaaggtgaaacttaccaagcgatagaaaaacttacgcaaggcagt
gtttacctaaaatctaagcgtaaagacgaacgcaatctgcttaccgaagcgcaagaccaa
ggctacagcctagctttcagccgagacatgttggcacaagcaaaaggcgacaaactactt
ggcctattcgcttactcaggtatggatgatggtattgcttatagcaacagcaaaaacgat
ccaaaacgcacacaaccatcgttgaaagagatgacggtcaaagcgcttgatgttctttct
aaagacaaagacggcttcttcttgatggttgaaggtggtcaaatcgactgggctggccac
agtaacgatgctggtaccatgctacatgagttgattaagttcgacgaagcggtgaactct
gtttacgagtgggcaaaaggtcgtgacgacacacttatcattgttaccgcagaccacgaa
acaggttcttttggctttagctactcatcagcaaatctacctaaaccagaaaaacgcaaa
ggtgaagcctttgaaaaacgtgattacgcgccaaacttcaacttcggtaagtttgaaatc
ctagatggtttatacaaccagaagaaaagctactatggcatgatcagcgagtttgaagcg
ctagataaagcacagcaaacaccagaaaagctagctgaagtggtaaataccaacagcgat
tttcctatcacacctgagcaagccgctcatgtactagcaagcaaaccaaacccataccga
gttgctggccactcgtacctagaagtagaaaccgtaccaacaattaacgactttgatgcg
ttcttcccatacaacgaccgcggtaacttgctcgctcgcgaacaagcgaccaaacaaaac
acggtatggggaacaggcacgcacactcatacaccagtgaacgtattcgcttgggggcct
gcagaaaccattcttccagtttcaaaaatcatgcaccactccgagcttggtgaattccta
aagcaacaaatcaaataa

DBGET integrated database retrieval system