KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_01530Help
Entry
M636_01530        CDS       T02760                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vpk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:314382..315731
Genome map
AA seq 449 aa AA seqDB search
MSGLQETQSAGANVILHAFDWKYADIAQRANEIHQLGYGSVLVSPPMKSAHDERWWQRYQ
PQDYRVIDNALGDTQDFIYMVRELERVGVLVYADVVFNHMANEAHLRRDLQYPRQDVLDQ
YRQDEHKYQSLKLFGDLSKPLFSEEDFVEAFGIKDWKDKWQVQNGRITGGPTDPGLPTLR
VCEHVVEQQRAYLKALKAIGVKGFRIDAAKHMTLEHLKRVWTDDITQDVHIFGEIITDGG
ATEEEYQLFLEPYLQETRLGAYDFPLFSTIFKAFSKKGSFKSLIDPYCFGQALSNGRAIT
FVVTHDIPNNDVFLDLIMDEEDEWIAYAYILGRDGGVPLVYTDLDTSGIKNKNGKPRWKD
AWNDPRMAKMIAFHNVTHGESMTVLEGNDDMLVLKRGEKGIVVLNKSTRAQSLSLKTECD
WFDLMSDQSVKAGIELKVPAKSFMLLVQK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaacgcaatcagcaggtgcaaacgtgattttgcacgcctttgat
tggaagtacgctgacattgcccaacgagcaaatgaaatccaccagctaggttatggctcg
gtgctggtttcgccaccaatgaaaagcgcccacgatgaacgttggtggcagcgctatcaa
ccacaagattaccgtgttatcgacaacgcgctcggtgacacccaagacttcatctatatg
gttcgtgagctcgaacgcgtaggcgttttggtatacgccgatgtggtgtttaaccacatg
gctaacgaagcacatttacgccgtgatctgcaatatcctcgtcaggacgtgttagatcaa
taccgacaagacgaacataaataccagtctctgaagcttttcggcgatttatccaaaccg
ctatttagtgaagaagattttgttgaagcgtttggtatcaaagactggaaagataaatgg
caggtccaaaatggccgaattacaggtggaccaaccgatcctggtttaccaacccttcgc
gtttgtgaacatgttgtcgagcagcagcgagcttacttaaaagcattgaaagcgataggt
gtgaaaggcttccgtattgatgccgcgaagcacatgacgcttgaacacctaaaacgcgta
tggacagacgatataacccaagatgtgcatatttttggggaaatcattaccgatggcggt
gcaacagaagaagagtatcaactgtttcttgagccgtatttacaagaaacccgtttaggt
gcgtatgatttcccgctgttttcgaccatctttaaagcattttcaaaaaaaggcagtttc
aagtctctgattgacccttactgttttggccaagcactttcaaacggtcgagccattact
tttgtggtgacgcatgatattcccaacaacgacgtctttctcgacttgataatggatgaa
gaggatgagtggatcgcttatgcctacattcttggtcgcgatggcggcgtgcctttggtt
tataccgatctggataccagcggcattaagaataaaaatggaaagccaagatggaaagac
gcttggaatgatcctcgtatggcgaagatgattgcgttccacaatgtgactcatggcgaa
tcaatgacggtactggaagggaatgacgatatgctagtgctaaaacgcggagagaaaggc
attgtagtgctaaacaaatccacgcgcgcacaatcgctatcgctaaagacagagtgtgat
tggttcgatttgatgtcagatcaaagcgttaaagccgggatagaactgaaggttccggca
aagtcgttcatgttattggtgcaaaaataa

DBGET integrated database retrieval system