KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_02720Help
Entry
M636_02720        CDS       T02760                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    M636_02720
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    M636_02720
Enzymes [BR:vpk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     M636_02720
Lipid biosynthesis proteins [BR:vpk01004]
 Desaturase
  First
   M636_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(590980..592104)
Genome map
AA seq 374 aa AA seqDB search
MNQNKPPFIWLNILIFSASFVLTFIVMPWYAYHYGLGWEHLIWGILAFSFTNLSITAGYH
RLWSHKTYEAHTVLRTIFAIGGAFSLQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFWY
SHIGWMLRDYNKSKENEYTNCRDLKRDGIVMWQHKYYVPLALLTNIGFPVALGLIYEDVW
GMLLVVGAARLFLSHHTTFFINSLAHVWGKQTFTDKNTARDNGVLAFFTFGEGYHNFHHI
FENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTTSTFRIEKARATQLLKKAKEKLESK
PNAQTVLDQLQQEFDALVHHMQEYYEARKELLGEKTASVVKKYECSVSKLKYQQLKTEFE
RQQRSWNLMIRRYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaaaacaaaccaccatttatctggttgaatatattgattttttcagccagtttt
gttctaacgtttattgtaatgccttggtacgcatatcattatggactgggctgggagcac
ttgatttggggtatccttgcattcagtttcactaacctgtcgattactgcgggatatcat
cgcctttggagccataaaacttacgaagctcatactgtattacgtacaattttcgcgatt
ggcggcgctttttctctccaaaacagtgcattacactggtcttctgatcaccgagtgcat
cacaaacatgtcgataacaatgacaaagatccctactccgccaaacgtggcttttggtat
tcacatattggctggatgttgcgcgactacaataagtctaaagaaaatgagtacaccaat
tgccgcgatctaaaacgcgatgggattgtgatgtggcaacacaagtactacgtgccgtta
gctttgctgactaatatcggtttccctgtagctttgggtcttatctatgaggatgtttgg
ggaatgctgctggttgttggcgcagctcgcctgttcttgagccatcacacaaccttcttt
attaactctttggcgcatgtttggggcaagcaaacttttacggacaaaaatacggcccgc
gataacggtgtcttggccttctttacctttggcgagggttaccacaattttcaccacatc
tttgagaatgactaccgcaatggtgtttattggtggcactacgatccaactaaatggctg
atcaagtcttgttcttggttgggactgacgtccaagcttcgcactacatcaactttccga
attgaaaaagcgcgagcaacccagttgttgaagaaagcgaaagagaaactggagtccaaa
cccaatgcgcaaactgttctcgatcagcttcagcaagagtttgatgcattggttcaccac
atgcaggaatactacgaagcacgcaaagagttgctcggagaaaaaactgcaagcgtagtg
aagaaatacgagtgctctgtatcaaaattgaagtatcaacaacttaaaactgagtttgag
cgtcaacaacgcagttggaacttgatgatccgtcgttacgcataa

DBGET integrated database retrieval system