KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_04380Help
Entry
M636_04380        CDS       T02760                                 

Definition
cytochrome C oxidase subunit II
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M636_04380
Enzymes [BR:vpk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M636_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(965276..966799)
Genome map
AA seq 507 aa AA seqDB search
MKTFKLKRTFLPLTLLLSAPAFAGQNGTMMQYFHWYVPNDGALWTQVESNAPALAENGFT
ALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKAQYISAINAAHNNNIQI
YGDVVFNHRGGADGKSWVDTKRVDWDNRNIELGDKWIEAWVEFNFPGRNDKYSNFHWTWY
HFDGVDWDDAGKEKAIFKFKGEGKAWDWEVSSEKGNYDYLMYADLDMDHPEVKQELKDWG
EWYINMTGVDGFRMDAVKHIKYQYLQEWIDHLRWKTGKELFTVGEYWNYDVNQLHNFITK
TSGSMSLFDAPLHMNFYNASKSGGNYDMRQIMNGTLMKDNPVKAVTLVENHDTQPLQALE
STVDWWFKPLAYAFILLREEGYPSVFYADYYGAQYSDKGYNINMAKVPYIEELVTLRKEY
AYGKQNSYLDHWDVIGWTREGDAEHPNSMAVIMSDGPGGTKWMYTGKPSTRYVDKLGIRT
EEVWTDANGWAEFPVNGGSVSVWVGVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcaaattaaaacgcacttttttaccgctaaccttgctgctcagtgctcct
gcctttgctgggcaaaatggtaccatgatgcagtattttcattggtacgtacctaatgat
ggcgcattatggacgcaggttgaaagcaatgctccagcactcgctgaaaacggttttaca
gcgctctggctaccgccagcttacaaaggcgcgggcggcagtaatgacgtcggttatggc
gtctatgatatgtacgatttaggtgagtttgaccaaaaaggctcagtacgaaccaaatac
ggcaccaaggctcagtacatctctgcaatcaatgccgcgcacaacaacaatatccaaatt
tacggcgacgttgtgtttaaccaccgaggtggcgcagatgggaagtcgtgggtcgatacc
aagcgcgttgattgggacaaccgcaacattgagctgggcgacaaatggattgaagcttgg
gttgagtttaattttcctggccgcaacgacaaatactcgaacttccattggacttggtat
cactttgacggtgttgactgggatgacgccggcaaagaaaaagcgatctttaaattcaaa
ggcgaaggaaaagcatgggattgggaagtcagctctgaaaaaggcaattacgactaccta
atgtacgccgatttagacatggatcacccagaagttaaacaagagctgaaagattggggt
gagtggtacatcaacatgaccggcgttgatggctttagaatggatgccgtgaagcacatt
aaatatcagtatctacaagagtggattgatcatttacgttggaaaacaggcaaagagctt
ttcaccgttggtgaatattggaattacgacgtaaatcaactgcataactttattactaag
acctctggcagtatgtcgttgttcgatgcgccgcttcacatgaacttctacaacgcgtca
aaatctggcggcaattacgatatgcgccaaatcatgaatggcacgttgatgaaggacaac
ccagtcaaagcagtgactctcgtagaaaaccacgatacacagccactgcaggcgttagag
tcgacagtagattggtggttcaagcctcttgcttacgcattcattttattgcgtgaagaa
ggttatccgtcggtgttctacgcagattactacggcgcgcagtacagcgacaaaggctac
aacatcaatatggccaaagtgccttacattgaagaacttgtaacactgcgtaaagagtat
gcgtatggcaaacagaattcttatctcgaccattgggatgtgattggctggacccgagag
ggcgatgctgaacatccaaactcaatggcggtgatcatgagtgatggaccgggcggcaca
aaatggatgtataccggtaagccaagcacgcgctatgtcgacaagctgggtatccgaact
gaagaagtttggaccgatgccaatggctgggcagaatttcctgtcaatggtggttcagtc
tcggtttgggtgggcgttaagtaa

DBGET integrated database retrieval system