KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_06910Help
Entry
M636_06910        CDS       T02760                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M636_06910
Enzymes [BR:vpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     M636_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1526099..1528279)
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEAKVSDETLRRLLTSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACFKQEDLNQHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVSSVPEFALSAEAQQRVGSAEFQQRLQKARDSHWVNYTEVSQLKMSVLPLLFSEFK
ARHLDKNTDRARAFLDFVEKGGESLLHQAAFDALHADLHAEDSGVWGWPVFPEKYRTFDA
AGTQKYIKDNQDRVHLYMYLQWIADDQIKEAQALAEEKGMAVGLYRDLAVGVADSGSETW
ADEGNLVLDASIGAPPDILGPLGQNWGLPPLNPQVLEATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEKQLEGLFADRLKCKQGILDSVRWHGYLPEGIGHDAQFVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRISKRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcggaaatggcgagattggctgatagctat
gtcagcgcgtggggagacgaggcaaaagtttctgacgagactctacgccgcttgctcact
tcactaggctacgatactagcagcgatgaaaaactattggcttctgctgaaaagaaacat
aagaaagacgtactagcccctgttcttgttttacgcgacggcgaaccagtcgaagtggaa
ctaaacctaggtacgagtgctcgtgagagtgaattcagctggcgtttagaaacagaacaa
ggagaggtacttgaaggctatcttcagtctcaaattgttcgtgatgagcgtgctgagggt
ggccctctagtgtttgcattgccaaagaacttggcatggggttaccacaaactgatcatc
agtcgcaagcgtcgtaaaacgccttacgagatgtcattgatcatcacaccgaaagcgtgt
ttcaaacaagaagacctaaaccaacacaaaaaactgtggggtccaagcattcagctttac
acactgcgtactcagcataactggggcatcggtgattttggcgacctaaaacagttggtg
agtgacattgcctctcgtggtggtgacttcattggcttgaacccaattcactcacttttc
ccagcaaacccagaaggtgcgagcccatacagcccatcttctcgtcgctggctgaacatc
atgtacatcgacgtaagctctgtacctgagtttgcgctaagtgcagaagcacaacagcga
gtgggcagcgcagagttccaacaacgtctacaaaaagcgcgtgactcacattgggtgaac
tacaccgaagtttctcaactaaaaatgagcgtattgccgctgctatttagtgagttcaag
gctcgtcatctcgataaaaacacggaccgcgctcgcgcattcttagatttcgtagagaag
ggcggcgaaagtttattgcaccaagcggcatttgatgcgcttcatgcagatttgcacgct
gaagattctggcgtttggggttggcctgtattccctgagaaataccgcacattcgacgcg
gctggcactcagaaatacatcaaagacaaccaagatcgcgttcacttgtacatgtaccta
caatggatcgcagacgatcaaatcaaagaagcgcaagccctagctgaagaaaaaggcatg
gctgtgggtctgtaccgcgaccttgctgtaggtgttgcagattctggcagtgaaacatgg
gcggatgaaggcaacctagtgctggatgcaagcatcggtgcgccaccagatattcttggc
cctctaggtcaaaactggggtctgccaccgcttaaccctcaagtgttggaagcgacaggc
tacgatgcgtacatcaagttgctacgtgccaacatgaagcattgtggtgcactgcgtatc
gaccacgtacttggcctattgcgtctatggtggattccaaaaggcgaaaaagcgacagaa
ggcgcgtacttgtactacccagtagaagacatgctcgcaatcctagcgcttgagtcgcac
cgtcatcagtgctctgtgattggtgaagacttaggtactgtgccagatgaaatcgttgat
atcctacgtgatgcgggcgtgcattcgtacaaagtcttcttcttcgaaacctcaaaagag
gacggcggctttatttctccgaagcattacgcagagcagtctatggcggcattgtgtacg
cacgacatgccaaccctacgcggcttctggcactgtgatgatttgaaaatgggtcgtgag
attggtctgtacccagatgaaaaacagttggaaggcttattcgctgaccgtttgaagtgc
aaacaaggcatcctagacagcgttcgttggcacggttacttgccagaaggcattggccat
gatgcgcagttcgtaccaatggattcatacctaagcgaagcgcttcaattgcacgttgct
gcgggtgattctgcactgcttagcgttcagcttgaagactggttagaaatggatcaaccg
gtcaacattcctggcacggttgatgagtatccaaactggcgtcgtaagctgtcgatgaac
ctagatgaaatcttcagtcgtgaagacgtgaatcgcatttctaaacgccttacagaagtt
cgcgcacaggcgagcaaataa

DBGET integrated database retrieval system