KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_09450Help
Entry
M636_09450        CDS       T02760                                 

Definition
peptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M636_09450
Enzymes [BR:vpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     M636_09450
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     M636_09450
Glycosyltransferases [BR:vpk01003]
 Polysaccharide
  Bacterial polysaccharide
   M636_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:250890..253262
Genome map
AA seq 790 aa AA seqDB search
MTDSKKPSAKKAPAKKSTASKGTTKRPRRTPSKKPTNEKRSWLKVLWSFSWKAGVALAAV
LLFVGIYLDSVVKERFDGQLFELPTVVYARILNLNPGENITIQELRNELDVLNYRKVSQP
RYPGEYSSSSTRVELIRRPFEFADGPEPDRHVMLHFSDSGLQRIQSLESKGDLGYLRLEP
KMLGMLEKDRDEQRLFLRRDQFPEILVDALLATEDRDFYQHDGVSPLAIARALVANIKAG
RTVQGGSTLTQQLAKNLFLTRDKTLWRKVREAYIALILDYRYSKDRILEAYLNEVYLGQS
GGEAIHGFGLASRYYFGQPIQELRIDQLAMLVGMVKGPSYYNPVRYPERTKERRDLVLRL
LMQQNMLTSQQYEQAVSRPLDTQSKPRIASRQPAYFQQLNIELKEKVGDRFKAETGLRVF
TSLDPVSQSKMEQAIAKKIPDLAKRGGKELEAAAVAVDRHSGEIRAMVGGKRVGYEGFNR
ALNASRPIGSLVKPAIYLTALEQPDKYNLGTTLHDTPLSLKGSKGSVWTPRNYDRKYRGD
VPLYLALAKSLNVPTVRLGMELGIPEVSGTLERLGVNKDEIRPVPSMFLGSFSLTPFEVA
QMYQTLTNSGKRAKLTALRSVIDMDGNVLYQSLPRSSRAVDEQAAWLTTYAMKQGVAQGT
GRYLQSQFAWAALAGKTGTSNDTRDSWFVGIDGREVTTIWLGRDDNKPINLTGSSGALRV
YAEYLAQRIPERLDLPWPKEVTTLGFKPTSNGGLEMNCRSDYKLPIWDKTGQIKQQCEKK
SNWLNSLFDW
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgactgacagtaagaagccaagcgccaagaaagcgcctgcgaagaaaagtacagccagc
aaaggcaccacaaaacgccctcgtcgcacgccgagtaaaaagccaaccaacgagaaacgt
tcttggctcaaagtgttgtggtcttttagctggaaggccggcgttgctcttgccgcggtg
ttgctgtttgttggtatttacctagatagtgtggttaaagaacgctttgatgggcagcta
ttcgaattgcctaccgttgtgtacgcgcgcattttgaacctcaatccaggtgaaaatatt
accattcaagagcttcgcaacgaattagatgtactgaactaccgcaaggtaagtcagcct
cgttatcctggtgagtattcttcttcttcgactcgtgttgaactgattcgccgtcctttt
gaatttgctgatggcccagaaccggatcgccacgtcatgctgcacttctcagacagtggt
ttacagcgtattcaatctttagagtcaaaaggcgatctaggctacttgcgccttgagcca
aagatgctggggatgcttgaaaaagatcgtgatgagcaacgtctgttcttacgtcgtgac
caattccctgaaattttagttgatgccttgttggcgacagaagaccgagacttctatcag
catgatggtgtttcaccattggctattgcccgtgctttagtggcgaacatcaaagcgggt
cgcaccgtgcaaggtggcagtaccttaacgcagcagctagcgaaaaacttatttctaacc
cgtgataaaacactgtggcgtaaggtgcgcgaagcttatattgcgcttattcttgattac
cgttacagcaaagaccgcattttagaagcctacctcaatgaagtatatttgggccaaagc
ggcggcgaagcgatccacggttttggcttagcatcacgctactactttgggcagccaatc
caagagttgcgaattgatcaacttgcgatgctggtgggcatggtgaaaggaccgtcgtat
tacaatcctgttcgctatcctgagcgcactaaagagcgtcgagacttggtgcttcgattg
ctgatgcaacaaaacatgctcacatcgcagcaatatgaacaagctgtgagtcgacctctt
gatacacaaagcaaaccacgtattgcgagccgtcagcctgcatacttccagcaattgaat
atcgagctgaaagagaaggtcggtgatcgcttcaaggctgaaactggtctgcgcgtgttt
acgtctctcgatcctgtctctcaaagtaaaatggagcaggctatcgcgaagaaaataccg
gatttagctaagcgaggcggcaaagaactcgaagctgctgccgtggctgttgatcgccac
agtggtgaaattcgtgccatggttggtggtaaacgcgtgggttatgaaggctttaaccgt
gcgcttaatgctagtcgtccaattggttcgttggtcaagccggcaatttacctgaccgcg
cttgaacagccagacaaatacaatttggggacgacgctgcacgacacgcctctaagtttg
aaaggtagcaaaggctcggtatggactccgcgtaactacgaccgtaaatatcgtggtgat
gtgccactttaccttgcgcttgcgaagtcattgaacgtaccaacggtaaggttggggatg
gagcttggtattcctgaagtatctggcacacttgaacgcttaggcgtcaacaaagatgag
attcgtcctgtgccttctatgttcttgggctcgttttcattgacgccatttgaagtggcg
caaatgtaccaaacactgactaactcgggtaaacgcgctaagctgaccgcgcttcgttcc
gtcatcgatatggacggtaacgtgctttatcaatcgttgcctcgttcctctcgcgcggtt
gatgaacaagcggcttggctaacgacttacgcgatgaaacaaggtgtcgcacaaggtacg
ggccgctaccttcaaagccaattcgcttgggctgcgttggcgggtaaaacgggcaccagt
aacgatactcgtgatagctggtttgtcgggattgatggtcgtgaagtgacgaccatttgg
ctaggccgtgatgataacaagccaatcaaccttacgggctcaagcggtgcattgcgtgtt
tacgcggaatacttggcgcagcgaattcctgagcgtttggatttgccttggcctaaagaa
gtgacgacgcttggctttaaaccgacctccaacggtggtttagagatgaattgccgcagc
gattacaaacttccaatatgggataaaacgggtcaaatcaaacaacagtgtgagaaaaaa
tctaactggttgaatagtttgtttgattggtag

DBGET integrated database retrieval system