KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_09775Help
Entry
M636_09775        CDS       T02760                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M636_09775
Enzymes [BR:vpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     M636_09775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:331511..332839
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEVLTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLEAIPGYNITPTNEVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAENTDDARAKL
MEVLDNGKAAACFGKMVAGLGGPADFVENYDNYLEKAEIIKPVYATETGIVSAMDTRAIG
MAVVSMGGGRRVATDEIDYAVGFDNFIRLGEVADSDKPLAVIHARSEEQWEEAAKALRSA
IKVGGEYTPTPEVYRQIRAEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccacaagaaatcattcgtaaaaaacgtgacggcgaagtcctaacagccgac
gaaatcaacttctttattcaaggcgtagcgaacaacacggtatctgaaggtcagattgcg
gcgtttgctatgacgattttctttaatgaaatgaccatggatgagcgcatcgccctaacg
tgtgcaatgcgtgactcaggcatggttatcgactggagccacatgaacttcggtggtcca
attgtcgacaaacactcaaccggtggtgtgggtgacgtaacttctctgatgcttggccct
atggtggcagcatgtggcggtttcgtacctatgatctctggtcgtggccttggccacaca
ggcggcacgctagataaacttgaagcgattcctggctacaacatcactccaacgaacgaa
gtttttggtcaagtaaccaaagatgcgggtgtggcgatcatcggtcaaacgggcgatctt
gctccggcggataagcgcgtgtacgcgactcgtgatatcacggctaccgtagacaacatc
tcactgatcacggcatcgatcctgtctaagaaattggcagcgggtctggaatctctagtg
atggacgtaaaagtcggttctggcgcatttatgccaacttacgaagcgtctgaagagcta
gcaaaatctatcgttgctgtagcaaatggtgcaggcacgaagactaccgcaatccttacg
gacatgaaccaagtactggcttcttctgctggtaacgcggtggaagttcgtgaagcggtt
cgtttcttaacaggtgaataccgcaacccgcgtctacttgaagtgacgatggcatcatgt
gctgaaatgctcgtgcttggcaaactggctgagaacacagacgacgcacgcgcgaaactg
atggaagtgctagacaacggtaaagcagcagcttgcttcggcaaaatggttgcgggtctt
ggcggcccagctgacttcgtcgaaaactacgataactacctagaaaaagcagaaatcatc
aagccagtttatgcgacagaaacaggtattgtctctgcaatggacacgcgtgctatcggc
atggctgtggtttctatgggtggcggtcgccgtgttgcaactgatgaaatcgactacgcg
gtaggttttgataacttcatccgattgggtgaagtcgctgatagcgataaacctctagca
gttatccacgctcgcagtgaagagcagtgggaagaagcggcaaaagcactacgcagtgca
atcaaagtgggtggtgaatacacgccaactccagaggtttaccgtcaaattcgtgcagaa
gacatctaa

DBGET integrated database retrieval system