KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_11100Help
Entry
M636_11100        CDS       T02760                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M636_11100
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M636_11100
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M636_11100
Enzymes [BR:vpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     M636_11100
Exosome [BR:vpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M636_11100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(611149..612726)
Genome map
AA seq 525 aa AA seqDB search
MKRLVSPIITAVAASTLSFNALSAEIKNVILMIGDGMGPQQVGLLETYANHAPNSIYKGQ
TTALYKLAQEGVIGSSLTNPEDAIVVDSACSATMLATGIPTASEVIGIDSQGNHVETILE
KAKSKGKATGLVSDTRMTHATPAAFAAHQPHRSLENNIASDMLESGVDVLLSGGLRHWIP
KSTNDKGETYQALEKLTQGSVYLKSKRKDERNLLTEAQDQGYSLAFSRGMLAQAKGDKLL
GLFAYSGMDDGIAYSNSKNDPKRTQPSLKEMTVKALDVLSKDKDGFFLMVEGGQIDWAGH
SNDAGTMLHELIKFDEAVNSVYEWAKGRDDTLIIVTADHETGSFGFSYSSANLPKPEKRK
GEAFEKRDYAPNFNFGKFEILDGLYNQKKSYYGMISEFEALDKAQQTPEKLAEVVNANSD
FSITPEQAAHVLASKPNPYRVAGHSYLEVETVPTINDFDAFFPYNDRGNLLAREQATKQN
TVWGTGTHTHTPVNVFAWGPAETILPVSKIMHHSELGEFLKQQIK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtttagtttctccgattattactgcagtggctgcatctacactttcattcaat
gcgctatccgctgaaatcaaaaacgttattctgatgattggtgatggtatgggtcctcag
caagtcggcttgctagaaacctacgcgaaccacgcaccaaactcgatttacaaaggccaa
accaccgcgctctacaagttagcgcaagaaggtgtgattggctcatctttaacgaaccca
gaagatgcgatcgttgtcgactctgcatgttcggcaacaatgctcgcaacaggtatccca
accgcatcagaagtgattggtattgacagccaaggcaatcacgttgagaccattttggaa
aaagccaagagcaaaggcaaagcaacgggtcttgtttcagatacgcgtatgactcatgca
acaccagccgcgtttgctgcgcatcaacctcatcgctcgctagaaaacaacatcgcttcc
gatatgctagaaagcggtgtcgacgtgttgttatctggtggtcttcgtcactggattcca
aaatcgactaacgacaaaggtgaaacttaccaagcgctagaaaaacttacgcaaggcagt
gtttacctaaaatctaagcgtaaagacgaacgcaatctgcttaccgaagcgcaagaccaa
ggctacagcctagctttcagccgaggcatgttggcacaagcaaaaggcgacaaactactt
ggcttgttcgcttactcaggtatggatgatggtattgcttatagcaacagcaaaaacgat
ccaaaacgcacacaaccatcgttgaaagagatgacggtcaaagcgcttgatgttctttct
aaagacaaagacggcttcttcttgatggttgaaggtggtcaaatagactgggctggccac
agtaacgatgctggtaccatgctacatgagttgattaagttcgacgaagcagtgaactca
gtttacgagtgggcgaaaggtcgtgacgacacacttatcattgttaccgcagaccacgaa
acaggttcttttggctttagctactcatcagcaaatctacctaaaccagaaaaacgcaaa
ggtgaagcctttgaaaaacgtgattacgcgccaaacttcaacttcggtaagtttgaaatc
ctagatggtttatacaaccagaagaaaagctactacggcatgatcagcgagtttgaagcg
ctagataaagcacagcaaacaccagaaaagctagctgaagtggtgaatgccaacagcgat
ttttctatcacacctgagcaagccgctcatgtcctagcaagcaaaccaaacccatacaga
gttgctggccactcgtacctagaagtagaaacggtaccaacaattaacgactttgatgcg
ttcttcccatacaacgaccgcggtaacttgctcgctcgcgaacaagcgaccaaacaaaac
acggtatggggaacaggcacgcacactcatacaccagtgaacgtgttcgcttgggggcct
gcagaaaccattcttccagtttcaaaaatcatgcaccactccgagcttggtgagttccta
aagcaacaaatcaaataa

DBGET integrated database retrieval system