KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_16035Help
Entry
M636_16035        CDS       T02760                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M636_16035
Enzymes [BR:vpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M636_16035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1687695..1688273)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGVGKVSSRIGLQSDAH
LFRPDTNLYQEIAALHEVEKRHCILIDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIKEGDQVAIGGNDRYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtatttctattactcagcaatgaatgcgggtaaatcgacaactcttctt
caatcttcatttaactaccaagaacgcggtatgacgccagtgattttcactgcggcgttg
gacgaccgctatggtgtaggcaaagtaagttctcgtattggtttacagtcggacgcgcat
ttgttccgtccagatacgaacctataccaagagattgcagccctgcatgaagtcgaaaaa
cgtcactgtattcttattgacgagtgtcagttcctatcgaaagagcaggtttaccaactt
acagaggtagtggataagctgcatattccagtactttgctatggtcttcgtaccgatttt
cttggcgaactttttgaaggcagtaagtacctactctcttgggctgataagctggttgag
ttgaagacgatttgccactgtggccgaaaagcaaacatggttatccgcaccgacgaacac
ggagtcgcaatcaaagaaggtgaccaagtggcaattggtggcaacgaccgttatgtctcg
gtttgccgtcagcactacaaagaagccctaggtaaataa

DBGET integrated database retrieval system