KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_17040Help
Entry
M636_17040        CDS       T02760                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    M636_17040
   01230 Biosynthesis of amino acids
    M636_17040
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M636_17040
   00290 Valine, leucine and isoleucine biosynthesis
    M636_17040
Enzymes [BR:vpk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M636_17040
    2.6.1.66  valine---pyruvate transaminase
     M636_17040
Amino acid related enzymes [BR:vpk01007]
 Aminotransferase (transaminase)
  Class I
   M636_17040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1909537..1910751
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGNPVHYLCDEQSDWYPDLDDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAFELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLETAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagttgaacatt
ggtaaccctgccccatttggttttgacgcccctgatgagattcttgtagatgtaattcgt
aatctaccgacctctcaaggctactgtgattccaaaggcatttactctgcgcgtaaagcg
gtggttcaacattaccaacgcaaaggcattcgttctttagacgtagaagatgtgtacgtc
ggtaatggcgtgtctgagctgatcgtgatggcaatgcaagcgttgctaaacaacggcgat
gaaatgctcatccctgcgcctgactacccattgtggacggcatcagtagcgttgtctggt
ggcaaccccgttcattatctgtgtgatgaacaatcggattggtatccagaccttgatgac
atcaaaaagaaaatcacgccgaagacccgcggtattgttctgatcaacccgaacaatcca
acaggtgctgtatatagtcgtgacttcttgcttgaagtgattgagattgctcgccaacac
aagctgatcattttcgctgacgagatttacgacaaagtgctttacgatggcgcaacacac
acttctgttgcgacgctaacggaagacgtacttgtgatgaccttcaacgggttgtcgaaa
gcttaccgtgtatgtggtttccgcggtgggtggatgttcttaactggtccaaaacactta
gcacaaggctacgttaacggtctagagttgctctcttctatgcgtctttgtgccaacgtg
ccgatgcaacatgcgattcaaaccgcgctaggtggctaccaaagtatcaatgagttgatc
ttacctggtggccgattgctagagcagcgtaatcgcgcgttcgagctgatcaaccagatc
ccaggggtatcttgtgtgaaacccaaaggtgccatgtacttattccctaaaatcgatacc
aagatgtacaacatcaagaatgaccagcagatggtgctcgatttcttgaaacaggaaaaa
gtactgctagtacaaggctcaggttttaactggccaaaaccagaccatttccgcattgtg
actttgccacacgttgaagatctggaaaccgcaatcggacgcttcgagcgattcctatca
acctacagccagtaa

DBGET integrated database retrieval system