KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_18460Help
Entry
M636_18460        CDS       T02760                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpk01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vpk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2193982..2195121)
Genome map
AA seq 379 aa AA seqDB search
MTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVMVSSG
AIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIYGIKIGQMLLTRADLDDR
ERFLNARDTINALVANDIIPIVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGSAPNVIFDSLSTEPQGTRFLPCSEALENRKRWILAGPAASGDIIIDDGAVNAVVG
KGSSLLAKGVIKVSGDFARGEVARVTNSHGKLVARGISAYSSEDLAKITGKHSKDIISIL
GHDYGSEVIHRDDLVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaaacgcagttgtttcgcaaccacaaaccgtcgttgtgaaactg
ggtacaagtgtgctgacaggcggcacattggcactagatcgcgctcacatggttgagcta
gcgcgtcagtgtgctgagcttaagaaacaaggccattcagtggtaatggtttcgtctggt
gcaattgcagcaggccgtgagcatcttggataccccgcactgcccaacgagatggcgagc
aaacagttgcttgctgctgtgggtcagagtcgtttgattcaaacatgggagtctttgttt
ggtatttacggtatcaagattggtcaaatgctactgactcgtgctgacttggatgatcgt
gagcgttttcttaatgcgcgtgacaccatcaatgcgcttgtggcgaacgatattattcca
atcgtgaacgaaaatgatgcagtagccaccagtgaaatcaaagtcggcgacaatgacaac
ctatcggctttagtgggtattttgtgtggtgcagataagttattgctactgacagaccaa
aaaggtctgtttactgctgacccacgaaaagatccgaatgcagagctgatcaaagaagtt
aaaaccattgatgacacgttgcgcaaaattgctggcggcagcggtacaacactcggtacg
ggtggtatggcgacgaaacttcaagcagccgacatcgcacgtcgcgcgggtattgaagtt
attatcgcagcaggtagcgcgccaaacgtaatttttgactcgttgagcacggagcctcaa
ggtacgcgtttcctaccttgttcagaagcattggaaaaccgtaagcgttggatcctcgca
ggtcctgcagcatcgggtgatattatcatcgatgatggtgcggtaaatgcggttgttggt
aaaggcagcagcttgctagcaaaaggggtcatcaaggtgagcggtgattttgcccgtggt
gaagttgctcgcgtaacaaattctcatggcaaactggttgcgcgtggtattagcgcctac
tcaagtgaagacttggcaaaaattactggcaaacacagtaaagacatcatctctattttg
ggtcatgactacggctcagaagtgattcatcgcgatgatcttgtcgtcattcaagaatag

DBGET integrated database retrieval system