KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_19280Help
Entry
M636_19280        CDS       T02760                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Brite
Enzymes [BR:vpk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     M636_19280
Secretion system [BR:vpk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   M636_19280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2378055..2378843)
Genome map
AA seq 262 aa AA seqDB search
MSVLRRLTLLTLPFFITACGAEESQAKTETPAQQAAPTAQQHFDEAALKAKFSKLGLSII
DIQPSDVAGLLEIQTNGGILFASNNGDHFIAGTLYAIDDNGGYKDVLAERQAPLNAEKIA
KFADSMIEYKADNEKYVVTVFTDITCGYCVRLHNQMQGYNDLGITVRYMAYPRQGATGPV
AEQMATIWCAEDPKAAMHNAKVSRTFDNPAKDLEQCKETIQAHYNVGRQLGISGTPAIFL
PNGEMVGGYLPPAELLKRLEQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgactaactctgctgactttaccattctttattaccgcgtgtggt
gcggaagaaagtcaggcaaaaaccgaaactcctgcacaacaggctgcgccaactgcgcaa
caacactttgatgaagcggcgctaaaagcgaagttctcgaaactaggtctatctattatt
gatattcaaccttcagatgtggcgggcctgctagaaattcaaaccaacggcggcatattg
tttgcgtcaaacaatggcgatcactttattgcaggtacgctatacgcgattgatgacaac
ggcggttacaaagacgtacttgcagaacgccaagcgcctttgaatgctgagaaaatcgct
aagtttgcagacagcatgatcgaatacaaagcggacaacgaaaagtacgtggtgacggta
tttactgacatcacttgtggctactgtgttcgtctgcataaccaaatgcagggctacaat
gatctaggtattactgttcgttacatggcataccctcgccaaggtgcgacagggcctgtt
gctgagcaaatggcaacgatttggtgtgcagaagatccaaaagcggcgatgcataacgcg
aaagtgagccgcactttcgataatccagcgaaagatcttgaacaatgtaaagagaccatc
caagcgcactacaacgttggtcgtcagttaggtatttcaggtacacctgcaatcttcctt
ccaaacggtgagatggttggtggttacttaccgccagctgaactactgaaacgtttagag
caactgtaa

DBGET integrated database retrieval system