KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_19610Help
Entry
M636_19610        CDS       T02760                                 

Definition
ubiquinol-cytochrome C reductase
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    M636_19610
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M636_19610
Enzymes [BR:vpk01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     M636_19610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2460347..2460937)
Genome map
AA seq 196 aa AA seqDB search
MSNAPLNNGRRRFLTATTAVVGGLGAVAVAVPFIKSWNPSAKAKAAGAPVEVDISKIEPG
QLVRVEWQGKPVWIVRRTQSVLDNLKTISDKLRDPQSEMEQQPEYAQNEFRSIKEEYFVA
VGFCTHLGCSPTYLPDSFSEQVQGVRSGFFCPCHGSKFDMAGRVFQGVPAPLNLVVPKHM
YLSDTKLIVGVDEGDA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcgcctttaaataacggtcgcaggcgttttctaaccgctacaacggcagtt
gttggtggattaggggcagtcgccgtcgccgtgccttttattaaatcatggaatccgagt
gctaaagccaaagcggcgggtgcaccggtggaagtggatataagtaaaattgaaccaggt
cagctggtacgtgttgagtggcaggggaaacctgtatggattgttcgccgtactcaaagc
gttctggataacctaaaaacgatcagtgataagcttcgtgatccacaatctgaaatggaa
cagcagccagagtacgctcagaatgagtttcgctcgattaaagaagagtactttgttgcc
gttggtttctgtactcaccttggttgttcacctacttacctaccagactctttctcagag
caggtgcagggtgtaaggtccggcttcttctgcccttgtcatggttctaagttcgatatg
gcaggccgagtattccaaggggtacctgctccattgaaccttgtcgttcctaaacacatg
tatttgagcgacaccaagctcattgtgggtgttgatgagggggatgcataa

DBGET integrated database retrieval system