KEGG   Vanderwaltozyma polyspora: Kpol_1000p18Help
Entry
Kpol_1000p18      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    Kpol_1000p18
   00514 Other types of O-glycan biosynthesis
    Kpol_1000p18
Enzymes [BR:vpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Kpol_1000p18
Glycosyltransferases [BR:vpo01003]
 O-Glycan biosynthesis
  O-linked Man type
   Kpol_1000p18
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 753 aa AA seqDB search
MAGVMKKRVTSKVDVDEPGNKYSKGAEKYQFLAERWLTSPLPDKEEVYKFWLYIVTGIAF
VTRFYKIWYPKEVVFDEVHFGKFASYYLERTYYFDVHPPFAKMLIAFVGWLSGYDGAFKF
DDIGLSYKKNPAPYIAYRSLNAILGTLTIPLMFNTMKELNFKAITCAFASLLVAVDNAHV
TETRLILLDATLVISIAASIYCYVKFYKVQLTAPFSHAWYIWLYLTGLSLSFVISSKYVG
VMTYAAIGTAVVVNLWQLLDIRAGLSLANFARHFIRRLSGLVFAPFVVYLFWFWCHFAIL
VNSGPGDPFMSQDFQETLLESPLAKESKQVQYYDIVTIKHRDTDAFLHSHDAFYPLRYDD
GRVSSQGQQVTGYSHDDINNQWEILPVKELASKNGHPVLQGEQIRLRHVQSNTYLLTHDV
ASPLYPTNEEVTTVSEEIANGENYKETLFTFQNLNKNDVNKQIKTKGTNFRIFHVDTSVA
LWTHNDELLPEWAFSQQEVNGNKKVTESSNNWFIDTIVNIDEARLKHIPKKTGTLPFLTK
WLELQRLMFEHNNKLSSEHPFASQPYSWPGSLSGVSFWTKDDERKQIYFIGNIIGWWFQV
VSLAAFIGIVIADMLTRQRGYFALNSITREKLYGPVMYLFVGWACHYFPFYLMGRQKFLH
HYLPAHLIASLFSAAIWEIIFSDTKSIDVHKDEKNDDVPEIKTKYYTIFLAVVSFAVIAF
FIYFAPFVYGDVSLTPEQVAQRKWLNMELHFAK
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgtcatgaagaaaagagttacatcgaaagttgatgtcgatgaacctgggaat
aagtacagcaaaggtgctgagaagtatcagtttttagccgagagatggttgacttctcct
ttgccagataaggaagaggtgtataagttttggttatacattgttactggtattgccttt
gttacaaggttttacaagatctggtatcctaaggaagttgttttcgatgaagttcatttt
ggtaagtttgcttcttattatttggagaggacttattactttgatgtgcatcctcctttt
gccaaaatgctgattgcatttgttggttggttatcaggatatgacggtgcttttaagttt
gatgatattggattatcttacaagaagaaccctgctccttacattgcttaccgttctttg
aatgcaattctaggtactttgactatcccactaatgttcaataccatgaaagaattgaat
ttcaaggcgataacttgtgcttttgcctctttgttggtcgctgtagacaatgcccacgtt
acagaaacaagattaattctattagatgctactttggttatatccattgcagcctctatt
tattgttatgttaagttttacaaagtccaattgactgctccattctctcatgcttggtac
atttggttatatctaacaggtttatcattgtcctttgttatttcctctaagtacgttggt
gtcatgacttatgctgctatcggtaccgctgtggttgttaacttatggcaattattagat
attcgtgctggtttaagtttggctaattttgctagacattttataagaagattaagtggt
ttggtctttgctccatttgttgtttatttgttttggttctggtgtcattttgcaatcttg
gtcaattccggtcctggtgatcctttcatgtcacaagactttcaagaaactttacttgaa
tcaccattagctaaagaatcaaaacaagttcaatattatgatattgttacaattaaacat
agagatactgatgctttcttacattcccatgatgcattttacccattacgttatgacgat
ggtcgtgtttcatctcaaggccagcaagttacaggttactctcatgatgatatcaacaat
caatgggaaattttacctgttaaggaattagcctcaaagaacggccatccagttttacaa
ggtgaacaaattagattaagacatgttcaatcaaatacctatttgcttacccatgatgta
gcctccccattatatccaacaaatgaagaagttactactgtttctgaagaaattgctaac
ggtgaaaattacaaggaaactttgttcacattccaaaacttgaacaaaaacgatgtaaac
aaacaaatcaagactaagggtactaatttccgtatctttcatgttgatacctctgttgcc
ttatggactcacaacgatgaactattgccagagtgggcttttagtcaacaagaagtcaac
ggtaacaagaaagttactgaatcatctaacaattggtttattgatacaattgtcaatatc
gatgaagctagattaaagcacatcccaaaaaagactggtaccttacctttcctaaccaaa
tggctcgaattacaaagattgatgtttgaacataacaacaaattatcttccgaacaccca
tttgcatctcaaccatactcatggcctggtagtttgagtggtgtctcattctggactaaa
gatgatgaaagaaaacaaatttactttattggtaacattattggttggtggttccaagtt
gtttcgttagctgcatttattggtatcgttattgccgacatgttaacaagacaacgtggt
tactttgctttaaattctatcaccagagaaaaattatatggtccagttatgtatttattt
gttggttgggcttgtcactacttcccattctacctaatgggccgtcaaaagtttttacat
cactatttacctgcccatctaatcgcttcattgttttctgctgctatttgggaaataata
tttagtgacaccaaatcaattgatgttcacaaggatgaaaagaatgatgatgtcccagaa
attaaaactaaatattatactattttcttagcagttgtttcctttgcagttattgctttc
ttcatatattttgctccatttgtttatggtgatgttagcttaactcccgaacaagtagca
caaagaaaatggttgaacatggagttacatttcgccaaataa

DBGET integrated database retrieval system