KEGG   Vanderwaltozyma polyspora: Kpol_1002p86Help
Entry
Kpol_1002p86      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Kpol_1002p86
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Kpol_1002p86
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Kpol_1002p86
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 161 aa AA seqDB search
MSKFYELAPSDKKGEPYSFSQLEGKVILIVNVASKCGFTPQYKELEELYQKHKDEGLVIL
GFPCNQFGHQEPGSDEEIAQFCTLNYGVTFPIMKKIEVNGNSVDPVYEFLKSQRAGILGF
RGIKWNFEKFLVDRKGEVYERYSSLTKPASIEGDIEKLLKQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttttacgaattagcaccaagtgataaaaaaggtgaaccatattcattctct
caattagaaggcaaggttatcttgattgtcaatgttgcttcaaaatgtggtttcactcct
caatataaggaattggaagaattatatcaaaaacataaagatgaaggtttagttatttta
ggtttcccttgtaatcagtttggtcaccaagaaccaggtagtgatgaagaaattgctcaa
ttttgtaccttgaattatggtgtcaccttcccaattatgaagaagatcgaagttaatggt
aacagtgtagacccagtttatgaatttttgaagagtcaaagggctggtatcctaggtttc
agaggcattaaatggaattttgaaaaattcttggtcgacagaaaaggtgaagtttatgaa
agatattcttctttgacaaaaccagcttcaattgaaggtgacatcgaaaaattgttaaaa
caataa

DBGET integrated database retrieval system