KEGG   Vanderwaltozyma polyspora: Kpol_1009p22Help
Entry
Kpol_1009p22      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Kpol_1009p22
    1.3.1.94  polyprenol reductase
     Kpol_1009p22
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 253 aa AA seqDB search
MDLIYLVTIGYRCSFVIGLLSLFIAKLYLPVFLQYGKTITKNNKGESNDSNVNKVLFKIE
HFTVPKSYFSHFYIISTILSIAVLKDYPKYPISWLLLVHSLRRLYETIYVSKYSKNSRMN
WSHYIVGIWFYSVLHLIVRIKLHQGKISKDINIVSLVIFIIASWDQYKNHRVLSELVKYS
LPTKRLFKICCSPHYFDEILIYSSFVSYNNEFIWLLIWVIASLSISAIETKAYYKDKFRH
QFVPNHAIIPFIL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggatcttatttatctggtcacaatcggctacagatgttcattcgttatagggttgcta
tcacttttcattgctaaattatatttacctgtttttttacaatatggtaagacaataact
aaaaataataagggagaaagtaatgattcaaatgttaataaggttcttttcaagatagaa
cattttacagtgcctaaatcatatttctcacatttttacataatatctactatcttatca
attgcagtgttgaaagattaccctaaatatccaatatcatggttattattagtacattca
ttgagaagactctatgaaaccatttatgtttctaaatattctaaaaattcaagaatgaat
tggtctcattacattgtaggaatatggttttactcagtattacacttaatagtaagaatt
aaactacatcaaggtaaaatttccaaagatatcaacatagtgtctctagtaatttttata
atagcatcatgggatcaatataaaaaccatagagtattatcagaattggtaaaatattcg
ttaccaacaaaaagactattcaaaatttgctgttcaccacattatttcgatgaaattcta
atttactcttcatttgtatcatacaacaacgaattcatatggttacttatctgggtaata
gcaagtctatctatatctgcaatcgaaaccaaagcttattataaagataaatttagacat
caatttgtcccgaatcatgcaattataccctttattttgtag

DBGET integrated database retrieval system