KEGG   Vanderwaltozyma polyspora: Kpol_1014p22Help
Entry
Kpol_1014p22      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
vpo  Vanderwaltozyma polyspora
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Kpol_1014p22
Messenger RNA biogenesis [BR:vpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Kpol_1014p22
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Kpol_1014p22
Translation factors [BR:vpo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Kpol_1014p22
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 200 aa AA seqDB search
MSVEEVSKKFEETVSVSGKVQVQHPLNSKWTLWYTKPAVDKSESWSDLLRPVTSFGSVEE
FWAVHENVPVPHELPLKSDYHIFRDQIRPEWEDTANAKGGKWSFQLRGGHGDVDELWLRA
LLSVIGETIDEEDSQINGIVLSVRRGTYKFALWTKSQEKEALCNIGARFKEVLKLGEEEK
IEFFPHSASTAKHAQPAIIL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgaagaagttagcaagaagtttgaagaaactgtttccgttagtgggaaagtt
caagtacaacatccattaaacagtaaatggactttatggtacactaagccagctgtggat
aaatcagagtcttggtctgatttattgcgtcccgttactagttttggtagtgtggaagag
ttttgggctgtccatgagaatgttcctgttccacatgaattgccattgaagtctgattac
catatctttagagatcaaatcagacctgaatgggaggatactgctaatgctaaaggtggt
aagtggtcattccagttgagaggtggccatggcgatgttgatgagttgtggttgagagct
ttgttgagtgttatcggtgaaaccattgatgaagaagattctcaaatcaatggtattgtc
ttgagtgttagaagaggtacttataaatttgctttatggactaaatctcaagaaaaggaa
gcgttatgcaacattggtgccagattcaaagaggttttgaagttgggtgaagaagaaaaa
atcgaattcttcccacattctgcctctactgcaaaacatgctcaacctgctattattttg
taa

DBGET integrated database retrieval system