KEGG   Vanderwaltozyma polyspora: Kpol_1018p103Help
Entry
Kpol_1018p103     CDS       T01049                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
vpo  Vanderwaltozyma polyspora
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:vpo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MSFYGSGSNTSSTGSTIATTKDMENDIVVNNAAEDSISDIAFSPQSDFLFSVSSWDNKVR
IWDIQGGVAQGRAQFEHAKPVLCTRWSLDGSKVASGGCDNIVNMYDVNSGQSQQIGTHSS
AIKSLRFVQCGPSNQECLVTGSWDKTIKYWDLRQPQPITTLALPDRVYSMDSKGKLLVVG
TADRNICIIDLNNPGNIFKSTLSPLKWQTRSIACFNEGDSFAIGSIEGRCAIRFVDDMQQ
KKLGFSFKCHRQNQGNTPSSNALVYPVNSIAVHPIYGTFVTAGSDGCFNFWDRNNRHRLK
AFPKQNYTIPVVSFNRQGTVLAYALSYDWFQGHTGNRQDYPNVIILHPTSDSEVLEKRK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcattttatggttctggaagtaatacatcatccacaggttcgactattgctacgact
aaagatatggagaatgatatagtagtaaacaatgctgctgaggactcaatttctgatatc
gcattttctcctcagagtgattttttattcagtgtcagttcatgggataataaagttaga
atatgggatattcaaggaggtgtagctcaaggaagggctcaattcgagcatgccaagcca
gtcttatgtacaagatggtcacttgatggttccaaagttgcttcaggaggttgtgataat
atagttaatatgtatgatgttaatagtgggcaaagtcaacaaattggaactcattcttca
gcaattaaaagtttaagatttgtacaatgtggtccaagtaatcaagagtgtttagtgaca
ggttcatgggataaaactatcaaatactgggatttaagacaaccgcagccaattactaca
ctcgctttaccggacagagtatattcgatggatagcaaaggtaaattattagtagttggg
acagctgatagaaatatttgtattattgatttaaataatcctgggaatattttcaagtcc
acactttcaccattgaaatggcaaacaagatcaattgcctgttttaatgaaggtgatagt
tttgcaattggttctattgaaggacgttgtgcaattaggtttgttgacgatatgcaacaa
aaaaaattaggattctcattcaaatgccatagacaaaatcaaggcaatacgccatcatca
aacgcattggtgtaccctgtgaatagtattgctgttcatcctatttatggcacctttgtc
actgcggggagtgatggctgttttaatttctgggacagaaacaacagacacagattaaaa
gcattcccaaaacaaaattacacaatcccagttgtctcatttaataggcaaggtaccgtt
ctggcttacgctttaagttatgactggttccaaggacacacaggaaataggcaagattat
cctaatgtaattatattgcatccaacatcagattctgaagtccttgagaagagaaaatag

DBGET integrated database retrieval system