KEGG   Vanderwaltozyma polyspora: Kpol_1018p106Help
Entry
Kpol_1018p106     CDS       T01049                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Kpol_1018p106
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    Kpol_1018p106
   04113 Meiosis - yeast
    Kpol_1018p106
Protein phosphatases and associated proteins [BR:vpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Kpol_1018p106
Ubiquitin system [BR:vpo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Kpol_1018p106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 753 aa AA seqDB search
MLFNSTSNHKNALADELTTDSTLNTIINIHDIIQQSISQLNFETAEFLSELLFSECSILE
NSNIHRIESIYLYSLSLYLNKKYHTALQISKDYKDLHLGISYIFGLCSLKLSSNINDAIK
SLSNIRDKSISSSSLIHFPNYATVSCLLGKLCNKLDRSKESAVYFSDALNKNPYLWEAYT
ELSKMRATIDLKKLYSIMTKKNQSHSFFSRNKFNSVTKNFATPFKSSSHFQTGLSSSSSS
SSNASSSSTNTISSNGNNNNNNNNNNNNAFNLNESQSQSLLQSARSSNKKSIPSNSILNK
TNVTVSTSGAGTLVGQSNIAAGTVTNSSTRQSPLPSQQIPQLMNQTSKSLPSTGNSSISS
SSLHRKGKLLTTPPARRQLMEKNSSYKTPRTHFNDHTNNNNFNSINNLEDSSLRRKSSSI
TKPQILSLSELLYIFARILKASSSFDSYKAIRLINSLVPNHIKDSMPWCQAQLGKLHFEL
VNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPNAPQTWCC
MGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDP
QHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYY
ELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVHFLLGQLYQILGR
KKDAVKEFTIAMNLDPKGNQLIIEALEKCHAQE
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaattccacctcaaatcataaaaatgcattggccgacgaattgactactgac
agcactctcaatacgatcataaatatacatgacatcatacaacagtccataagtcaattg
aattttgaaacggcagagtttctatctgaactcttgttctctgaatgttccattttggaa
aattcaaatattcacagaatcgaatcgatttatctctattctctttctttatatttgaac
aaaaaatatcatactgctttgcaaatttcgaaagattataaagatctacatttaggtatt
tcttacatattcggtttatgttctttgaaactgtcgtctaatataaatgacgctataaag
tctctttcaaacattagagataaatcgatttcaagctcaagtttaatacatttcccaaac
tatgctacagtcagttgtctactgggtaaactgtgcaataaactggatagatcaaaggaa
agcgctgtatacttctcagatgctctaaataaaaatccttatctatgggaagcttatact
gaattatcaaaaatgagagcaactatagatttgaaaaaattatattctataatgacaaaa
aaaaatcaatcacattctttcttctcaagaaataaatttaattcagtgacaaaaaatttt
gcaactccctttaaatcatcttctcatttccaaacaggtttaagctcttcttcttcgtcg
tcttcaaacgcttcttcttcttcgactaatacaatttcatcaaatggaaataacaataac
aacaacaataataacaataataatgcatttaatttgaatgaatctcaaagtcaaagtcta
ctacaatcagcacgttctagcaacaaaaaaagtatcccatcaaattctattttaaataag
acaaatgtaacagtatcaacatcaggggcaggtacactagtaggtcaatcaaatatagca
gcaggaactgtgacaaactcgtcaacaagacaatcccctctcccatctcaacaaattcca
caattaatgaaccaaacctccaaatcattaccttcaacaggcaatagcagcatatcttca
tcttcacttcatcggaaaggtaaattattgactacccctcctgcaagaagacagttaatg
gagaaaaattcttcctataaaactccaagaactcatttcaacgatcacacaaataataat
aactttaatagtatcaataacttggaagattcttcattacgtagaaaatcttcttcaata
acaaaaccacaaattttatcactttcggaactgctatatatatttgcaagaatactaaag
gcttcatcttcattcgattcttataaagcaattagattgatcaactcattagttccaaat
catataaaagatagcatgccatggtgtcaagcacaactgggtaagttacattttgaacta
gttaattatgacgtttctttacattatttcacaaatctaagaaaattacaacctaccagg
gttagcgatttggaaatctattcaactttattatggcatctacatgataaagttaaatta
agcattttagcaaatgaactagtcatgaatataccgaatgctccgcaaacttggtgttgc
atgggtaatttcctatcactacagaaagatcacgaagatgcaatcaaagcatttgaaaaa
gcaacgcaggtagatccaaattttgcatatgcatatactctgcaagggcatgagcattct
tcaaacgatagttttgacactgccaagaattgttatagaaaggcattagcttgtgatcct
caacattataatgcatactacggtttaggtatgagttgtatgaaattggggcagtatgac
gaagctttgcttcacttcgaaaaagctagatctattaatccaatcaatgtaatattaatt
tgttgctgtggtgttgcattagaaaaattacagtatcaagaaaaggcattaagttattat
gagttggcatgcgagttacaaccatcgtcatctttggcaaactttaaaagggcacatctt
ctatattctatgggtagatatagtgttgcattgcaatactttgaagaattaacaaaattg
gctccggatgaagcaactgttcacttcttacttggtcaattgtatcaaatattaggcaga
aaaaaagatgccgtaaaagaatttacaattgctatgaacttagatccaaaaggtaaccaa
ttaatcatagaagctttagaaaagtgtcatgctcaagaatag

DBGET integrated database retrieval system