KEGG   Vanderwaltozyma polyspora: Kpol_1018p12Help
Entry
Kpol_1018p12      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:vpo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vpo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vpo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vpo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:vpo00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 967 aa AA seqDB search
MTVTVPFVNGTSYSTLTAFSKDSFQEAVKFYKNLLALDQRTADDTSALLSNGPISIKLTL
KEDAALHADAMKARSHLLDPSISDDWRAKAPTSLVFNTMDITEVMNRFRALILPIQAFPN
DINPLLLYTVDPLGNVIGVTATKNAISTKPCVPASLLAEEQQKMKHELASKAVSYTDLSS
QFTKTTNAYPSLPTKTNASKADKAIAVMTSGGDAQGMNSNVRAIVRSAIFKGCRAFVVME
GYEGLVRGGPEYIKEVCWEDVRGWSTEGGTNIGTARCLEFRQREGRLLGAQHLIEAGVDA
LIVCGGDGSLTGADLFRSEWPSLIDELLKTNRISQEQYTRYQHLNICGTVGSIDNDMSTT
DATIGAYSALDRICTAVDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYIFIPE
NPPVPGKWQDGMCEIISQHRSHGKRTSIIIIAEGAIDTELNPIKPEDVHKVLCDRLKLDT
RITTLGHVQRGGTAVAYDRILATLQGVEAVNAVLESTADTPSPLIAINENKITRKPLIDS
VALTKSVADAIQAKDFEKAMSLRDTEFIEHFDNYMAINNADNGIPKLPADKRLKIAIVNV
GAPAGGINSAVYSMATYCMSQGHKPYAIYNGFSGLVRHESVRSLEWKDIIGWQSRGGSEI
GTNRVTPEEADIGMVAYYFQKYQFDGLIIVGGFEAFVSLNQLERGRDCYSAFRIPMVLIP
ATLSNNVPGTEYSLGSDTALNALMQYCDVVKQSAASTRGRVFVVDVQGGNSGYLATTAAL
AVGAQASYVPEEGISLPQLSQDIKMLGESFKEAKGRGRFGKIILKSTNASKALSAKQLAD
VISAEADGAFDAKVAIPGHVQQGGLPSPIDRTRATRLAVRAVSFIESRQDVMKASRAADE
EFDVDDKDVFETAAVLGVKGSHVVFTPIRQVYDNETDTDKRMPKIIHWQKTRDIADHLVG
RKKVNVK
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaactgtaccattcgttaacggtacttcttacagtactttaactgctttttca
aaagattctttccaagaagctgtcaaattttacaaaaatttattagctttagaccaacgt
actgcagatgatacctctgctttactatcaaatggtccaattagtattaaattaactttg
aaagaagatgcagctttacatgccgatgccatgaaagctcgttctcatcttttagatcct
tccatctctgacgattggagagctaaggctccaacttctttggttttcaacactatggat
attacagaagttatgaatagattcagagctttgatcttaccaattcaagctttcccaaat
gatattaacccattgttgttgtacactgtagatccattaggtaacgtcattggtgttaca
gctacaaagaatgccatcagtactaagccatgtgttccagcttctttacttgctgaagaa
caacaaaaaatgaaacacgaattggcttcaaaagctgtatcttacactgacttgtcttct
caattcaccaagactactaatgcttacccatccttaccaactaagaccaatgcttccaaa
gccgacaaagctattgctgttatgacctctggtggtgatgctcaaggtatgaactcaaac
gtcagagctattgttcgttctgctatcttcaaaggttgtcgtgcttttgtcgttatggaa
ggttacgaaggtttagttcgtggtggtccagaatacatcaaagaagtttgctgggaagat
gtccgtggttggtccactgaaggtggtaccaacatcggtactgcaagatgtttggaattc
agacaacgtgaaggtagattgttaggtgctcaacatttaatcgaagctggtgtcgacgct
ttgattgtctgtggtggtgacggttcattgactggtgctgatttattcagatctgaatgg
ccatctttaattgatgaattattgaagactaacagaatttctcaagaacaatacaccaga
tatcaacatttgaacatttgtggtactgttggttccattgacaatgatatgtctactact
gatgctaccatcggtgcttactctgctttggacagaatctgtactgctgtcgattacgtc
gaagctacagctaactcccattctagagctttcgttgtcgaagttatgggtagaaactgt
ggttggttagctttgttagctggtattgctacttctgctgattacatctttatcccggaa
aacccaccagttccaggtaaatggcaagacggcatgtgtgaaattatctcccaacacaga
tctcacggtaagagaacttctattattattattgctgaaggtgccatcgatactgaattg
aacccaattaagccagaagatgtccacaaggtcttgtgtgacagattgaaattagatacc
agaatcaccactttaggtcatgtccaaagaggtggtactgctgttgcctacgatcgtatt
ttggctactttgcaaggtgttgaagccgttaatgctgttttggaatccaccgctgataca
ccatctcctttaattgctattaacgagaacaagatcacccgtaaaccattgatcgactct
gttgctctaactaagtcagttgccgatgccattcaagctaaggacttcgaaaaggctatg
tcattaagagacactgaatttattgaacatttcgataactatatggccatcaacaatgct
gataatggtattccaaaattaccagctgacaagagattaaagattgctatcgttaacgtt
ggtgctccagctggtggtattaactctgccgtctattccatggctacttactgtatgtct
caaggtcacaaaccttatgctatatacaatggtttctccggtttagttagacatgaatct
gttcgttctctagaatggaaagatattatcggttggcaatctcgtggtggttctgaaatt
ggtaccaacagagtcaccccagaagaagctgatatcggtatggttgcttactacttccaa
aaataccaattcgatggtttgattattgtcggtggtttcgaagctttcgtttccttgaac
caattggaaagaggtagagactgttactctgctttcagaatcccaatggttttaatccca
gctactttgtctaataacgttccaggtactgaatattctttgggttctgatactgcatta
aatgccttaatgcaatactgtgatgttgttaagcaatccgctgcctccaccagaggtaga
gtattcgttgttgacgtccaaggtggcaattcaggttacttagccacaactgctgctttg
gctgttggtgctcaagcctcttatgttccagaagaaggtatctctttaccacaattatct
caagatatcaagatgttaggtgaatccttcaaggaagccaagggtagaggtagattcggt
aagattatcttgaagagtaccaatgcttcaaaggcattgagtgctaaacaattagcagat
gttatctctgctgaagctgacggtgctttcgacgctaaagttgccattccaggtcatgtc
caacaaggtggtttgccatctcctatcgatagaacaagggctaccagattggccgttaga
gccgttagtttcattgaatctcgtcaagatgtcatgaaggcttctcgtgctgccgatgaa
gaatttgatgtcgatgacaaagatgttttcgaaactgctgctgtcttgggtgttaaaggc
tctcacgttgtcttcactccaattagacaagtttacgataatgaaactgatacagacaag
agaatgccaaagatcatccactggcaaaagactagagacattgctgaccatttggtcggt
agaaagaaggttaacgtaaaataa

DBGET integrated database retrieval system