KEGG   Vanderwaltozyma polyspora: Kpol_1018p8Help
Entry
Kpol_1018p8       CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00061  Fatty acid biosynthesis
vpo00620  Pyruvate metabolism
vpo00640  Propanoate metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01212  Fatty acid metabolism
Module
vpo_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kpol_1018p8
   00640 Propanoate metabolism
    Kpol_1018p8
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Kpol_1018p8
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Kpol_1018p8
Enzymes [BR:vpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Kpol_1018p8
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Kpol_1018p8
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Kpol_1018p8
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ABC_tran_CTD ATP-grasp_3 Dala_Dala_lig_C
Motif
Other DBs
NCBI-GeneID: 5547843
NCBI-ProteinID: XP_001647339
UniProt: A7TDL1
AA seq 2231 aa AA seqDB search
MSEENLFDSSIEKPQYEVTDYSSKHSNLPPHFLGLNTINNSEESDLKEFVKSHGGHSIIS
KVLIANNGIAAVKEIRSVRKWAYETFGNERIVQFVAMATPEDLEANAEYIRMADQYIEVP
GGTNNNNYANVDLIVDIAERCDVDAVWAGWGHASENPHLPEKLTQSKRKVIFIGPPGNAM
RSLGDKISSTIVAQHAKVPCIPWSGTGVDKVHIDDQTGLVSVDDDIYEKGCCSSPEDGLV
KAKKIGFPVMIKASEGGGGKGIRKVEREEDFVSLYHQAANEIPGSPIFIMKLAGNARHLE
VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAPNVTFTEMEKAAVRLGKLVGYVS
AGTVEYLYSHEDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIRDIRV
LYGLNPHTATEIDFEFKSDSSLKTQRRPTPKGHCTACRITSEDPNEGFKPSGGTLHELNF
RSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLISQKMTAEKPDPTLAVICGAATKAFIASEDCHQEY
IASLKRGQVVQKSVLQTMFPVEFIHEGKRYKFTVAQSAEDKYTLFINGSKCEVRVRKLSD
GGLLINIDGKSHTIYWKDEVSATRLSVDGKSTLLEVENDPTQLRTPSPGKLVKFLVENGE
HIITGQPYAEVEVMKMQMPLVAQESGIIQLLKQPGSTISAGDIIAILTLDDPSKVKHALP
FEGMLPEYGSPTIEGTKPGYKFKSLVSTLENILNGYDNQVTMNSSLQQLIEVLRNAELPY
SEWNMNISALHARLPSKLDDQLNQLVERSSKRGASFPARQLTKILEVGVKQAEADASILS
ATVEPLFDITRRYENGLEAHEHAVFVGFLEEYYNVEKLFTGPNVREENIILKLRDENSEN
LERVVSIVLSHAKVSAKNNLMLSILKHYQPLCKMSSEVSSTFLPPLQHIVELDSKLTAKI
ALQAREILIQGALPTVKERTEQIEHILKSSVVKAAYGQANSKRMEPDAEILKSLIDSNFV
VFDVLTPFLSNSDPAVAAAAAQVYVRRAYRAYTVGEVRIHDSYTHPVCEWKFQLPSAAFA
AAPSISNKMGMNRAMSVSDLSFVVDSENAPLRTGLLIASEHLDDVDDALSQSLEVIPRPS
VSSGPGPARSNGNSSLSNVANVYVHSVEGFETEEDVLKRLTEILEVNKQSLIDSSIRRIT
FMFGYEDGTYPKYFTFKGPNYAEDETIRHIEPALAFQLELGRMSNFNIKPIFTENRNIHV
YEAVSKTSPLDKRFFTRGIIRTGSIRDEISIQEYLTSEAHRLMSDILDNLEIIDTSNSDL
NHIFINFSAVFDVSPEDVEAAFGGFLERFGKRLLRLRVSSAEIRIIIKDPVTGTPVPLRA
LINNVSGYVVKAELYTEVKSARGDWIFRSLGKPGSMHLRPIATPYPVKEWLQPKRYKAHL
MGTTYVYDFPELFRQAATNQWAKHSSKAKLSDNFFVSNELIEDENGELTEVEREAGANSI
GMVAFKITVKTPEYPRGRQFVVVANDITFKIGSFGPQEDEFFNKVTEYARKRGIPRIYLS
ANSGARIGVAEELIPLFKVAWNNANDPSEGFEYLYLTAEDMGELKKYDKENSVITERSVE
NGEERFVIKAIIGSEEGLGVECLRGSGLIAGATSRAYHDIFTITLVTCRSVGIGAYLVRL
GQRVIQIEGQPIILTGAPAINKVLGKEVYASNLQLGGTQIMYNNGVSHLTASDDMAGIEK
ILQWLSYIPAKRNMPVPIFESLDKWDRDVDYKPESNEQYDVRWMIEGRSSEQGFQYGLFD
KGSFFETLSGWAKGVVVGRARLGGIPLGVIAVETRLVENLVPADPANADSTETLIQEAGQ
VWYPNSAFKTAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPVMIYIPPTGELRGGSWVVVDPTINPEQMEMYADCEARAGVLEPEGMVTIKYRREKLLA
TMNRLDAKYRDLKNKLSDPNISTEDQQEISKQLATREKQLMPIYHQVTVQFADLHDRPSR
MLAKGVISKEIEWKNARRYFFWRIRRRLDEEYLIKRLDKELKDATRLEKIARIRSWYPAS
VNHEDDRQVCKWIEENYSTLEERFKGMKLESFAQDLAKSIRNDHDVAITGLSEVLKMLST
EDKEKILKNLK
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaaaccttttcgattcttctattgaaaaaccacaatacgaagtaaccgat
tattcaagcaaacattctaatttacctcctcatttcctaggtttaaatacaatcaataac
tcagaggaatctgatttaaaagaattcgttaaaagtcatggtggtcattccataatctca
aaagttttaatagcaaacaacggtatcgctgctgtaaaagaaataagatcagtaagaaaa
tgggcgtacgaaacttttggtaacgaaagaattgtccaattcgtagcaatggctactcct
gaagatttagaagcaaacgctgaatacattagaatggcagatcaatatatcgaagttcca
ggtggtacaaataacaataattatgcaaacgtggatttaatcgtagatatcgctgaaaga
tgtgatgtcgatgctgtttgggcaggttggggccatgcctctgaaaaccctcatttacct
gaaaaattaactcaatcaaagagaaaagtaatatttattggtcctccaggtaatgctatg
agatcgttaggtgataaaatctcaagtacaattgttgctcaacatgctaaggtaccttgt
attccttggtcaggtactggtgtcgacaaggtccatatcgatgatcaaaccggtcttgta
tcagtcgatgatgatatttatgaaaaaggttgttgttcatctcctgaagatggtctagta
aaggctaaaaaaatcggtttcccagttatgattaaagcctccgaaggtggtggtggtaaa
ggtattagaaaagtagaaagagaagaagattttgtctctttgtatcaccaagctgcaaat
gaaattccaggttctccaatatttatcatgaaactggctggtaatgcccgtcatttagaa
gtacaattattagccgatcaatatggtacgaatatctcattattcggtcgtgattgttca
gttcaaagaagacatcaaaaaattatagaagaggctcctgtaactatcgctcctaatgtt
actttcaccgaaatggaaaaagccgctgtaagactaggtaaattggttggttatgtttca
gcgggtactgtagagtacttatactctcacgaggatgataaattttatttcttggaatta
aatccaagattacaagttgagcatccaactacagaaatggtcagtggtgtaaatttacct
gcagcccaattacaaattgctatgggtatcccaatgcatagaattagagatattagagta
ttatacggattaaatcctcataccgctacagaaattgattttgaattcaaatctgacagc
tctttaaagacccaaagaagaccaactccaaagggccattgtactgcttgtcgtataact
tcagaagatccaaatgaaggttttaaaccatccggtggtactttacatgaattaaacttc
cgttcatcttctaacgtttggggttacttctccgtcggtaataatggtggtattcattct
ttctcagattctcaattcggtcatatatttgcatttggtgaaaatagacaagcttcaaga
aagcatatggtagtagcattaaaggaattatcaattagaggtgatttcagaactacagta
gaatacttaattaagttgttagaaacagaggattttgaagataacactataacaaccggt
tggttagatgatttaatttctcagaagatgacagctgaaaaaccagatccaactttagca
gttatttgtggtgctgcaactaaagcatttattgcttcagaggattgtcaccaagaatat
attgcgtcattgaagagaggtcaagtggttcagaaatcagtgttacaaactatgttccct
gttgaattcatccatgagggtaaaagatacaaattcacagtagcccaatcagctgaagac
aaatatacattatttattaatggatctaaatgtgaagtacgtgtacgcaagttatctgac
ggcggtttattgattaacatcgatggtaagtcacatactatttattggaaagatgaagtt
tctgcaactagactatctgtagatggtaaatcaactttacttgaagttgaaaatgatcca
actcaactacgtacaccttctccaggtaaattggttaagttccttgttgagaatggtgaa
catatcattactggtcaaccatatgccgaagttgaagttatgaaaatgcaaatgccttta
gtagctcaagagagtggtatcatacaattattaaaacaaccaggttctacgatatctgct
ggtgatatcattgcaattttaacattagatgatccgtctaaagtcaagcatgctttgcca
tttgaaggtatgttacctgaatatggctctccaacaatcgaaggaactaaaccaggttac
aaattcaaatccttagtctcaactctagagaatatcttaaatggttacgataatcaagtt
actatgaattcttcattacaacaattaatcgaagtactaagaaatgctgaattaccatat
tctgaatggaacatgaacatttccgcgttacacgctagattaccaagtaagcttgatgat
caattaaatcaactggtcgaacgttcttctaagcgtggtgcctcattcccagctagacaa
ttgacaaaaatattagaggttggtgtaaaacaagcagaagctgatgcatctattttatct
gctactgtagaaccactatttgatattacaagacgttatgagaatggtttagaggcacat
gaacacgctgtgtttgtgggctttttagaagagtactacaatgttgaaaagttgtttaca
ggtccaaatgtcagagaagaaaatataattttaaaattacgtgacgaaaattctgaaaat
ttggaaagagttgtttcaatagtgctgtctcatgcgaaggtgtctgccaagaataattta
atgctatccattttaaagcactatcagccactttgtaaaatgtcttctgaggtttcttca
acttttttgccaccattacaacatattgtggagctagattccaaattaactgctaaaatt
gcattacaagcaagagaaatcttaatccaaggtgctttaccaactgttaaggagagaact
gaacaaattgaacacattttgaagtcttctgttgtgaaggctgcttatggtcaagcaaat
tctaaacgtatggaaccagatgctgaaattttgaaatctttaattgattctaactttgta
gtattcgatgttttaactccatttttaagcaattctgacccagctgtagctgctgctgct
gcccaagtttatgttcgccgtgcttacagagcttatactgtaggcgaagttagaattcac
gattcatatacccatccggtttgtgaatggaaattccaattgccatctgctgcttttgct
gctgctccttcaattagcaacaaaatgggtatgaatagagcaatgtctgtatcagattta
tctttcgtggtcgatagcgaaaatgctcctttgagaactggtttgttaattgcatcagaa
catttggatgatgtagatgatgctttatctcaaagtttggaagttattccacgtccaagt
gtatcaagtggtccaggtcctgccagatcaaatggaaactcttcattaagtaacgtcgcc
aatgtttatgttcattctgttgaaggttttgaaactgaagaagatgttttaaaaagatta
actgaaattttagaggttaacaaacaatcactaatcgattcttcaatccgtcgtattacc
tttatgttcggttatgaagacggtacatatccaaagtatttcactttcaaaggtccaaac
tatgctgaggatgagactattcgtcacatcgagcctgctttagctttccaattagaatta
ggaagaatgtctaactttaacatcaagcctatttttaccgagaatagaaatattcatgtc
tacgaagcagttagtaaaacttctccattagataagagatttttcactaggggtattatt
agaacaggtagtattcgtgatgagatatccatccaggaatatttaacttcagaggctcat
agattaatgagtgatattttggataacttggaaattatagacacttctaattcggatttg
aaccatattttcatcaatttttcagctgtttttgacgtatctccagaagatgttgaagct
gccttcggcggcttcttggaaagatttggtaagcgtttgttgagattgcgcgtttcttct
gctgaaattcgtatcattattaaagatcctgttactggaactccagtaccacttcgtgct
ttgattaacaacgtttcaggttatgtagttaaggctgaattatataccgaagttaagagt
gctaggggtgactggatatttaggtcattgggtaaaccaggttctatgcacttgagacca
atcgcaactccataccctgtcaaggaatggttacaaccaaagcgttacaaagcccattta
atgggtaccacatatgtgtatgatttcccagaattattccgtcaagcagcaactaatcaa
tgggcaaaacattcttcaaaagctaagttatcagataatttttttgtttcaaatgaatta
attgaagatgaaaatggagaattgactgaagttgaaagagaagccggtgctaattctatt
ggtatggtcgcctttaagattactgttaaaacaccagaatatcctcgtggtcgtcaattt
gttgtagttgctaatgatattactttcaaaattggttcatttggcccacaagaagatgaa
ttctttaataaggttactgaatatgccagaaagcgtggtatcccaagaatttacttatct
gctaattctggtgctagaattggtgttgctgaggaattaattccattgtttaaggttgct
tggaataatgcaaatgacccaagtgaaggctttgaatatttgtacttgactgctgaagat
atgggagaattaaagaagtatgacaaggaaaattctgttattactgaaagatctgttgaa
aatggcgaggaaagatttgtcattaaggctattattggttctgaagaaggtcttggtgtt
gaatgtttgagaggttctggtctgattgccggtgcaacatcaagagcttatcatgacatt
tttacaattactttggttacttgtagatccgttggtatcggtgcatacctagttaggttg
ggtcaaagagttattcaaatcgaaggccaacctatcattttaactggtgctccagctatt
aacaaggtcttgggtaaggaagtctatgcatccaacttacagttaggtggtacacaaatt
atgtacaataatggtgtttctcatttgactgcgtctgatgatatggctggtattgaaaaa
attttacagtggttatcttatattccagccaaacgtaatatgcctgtcccaatttttgaa
agtttagataaatgggatagagatgttgattacaagcctgaatctaacgaacagtacgat
gtaagatggatgattgaaggtcgttccagcgagcagggtttccaatacggtttattcgat
aaaggttcattcttcgaaacattatctggatgggctaaaggtgtcgttgtcggtagagca
cgtctaggtggtatcccattgggtgttattgcagtcgagactaggttggttgaaaatttg
gtaccagctgatccagctaatgccgattctactgaaacattgattcaagaagccggtcaa
gtttggtatccaaattccgcattcaagaccgctcaagctattaacgattttaacaacggt
gaacaattaccattgatgattttagccaattggagaggtttctcaggtggtcaaagggac
atgtacaatgaagtcttgaaatatggttcctttattgttgatgctttagttgattacaaa
caaccagttatgatctatatcccaccaactggtgaattaagaggtggttcgtgggttgtt
gttgaccctactattaaccctgaacaaatggaaatgtacgctgattgtgaagctagagct
ggtgttttagaaccggaaggtatggtcactatcaagtaccgtagagaaaagttattggct
actatgaacagattggacgctaaatacagagatttgaaaaacaaattatctgatcctaac
atttctactgaagaccaacaagaaatttctaaacagttggctactagagaaaagcagttg
atgccaatttaccaccaagttacagtccaatttgccgatttacatgacagaccaagtcgt
atgttagctaagggtgttatctctaaggagatcgaatggaagaatgctcgtagatacttc
ttctggagaattagaagaagattagatgaagaatatttgatcaagagattagataaggaa
ttgaaggacgctactagattggaaaagattgcaagaatcagatcctggtatccagcttca
gttaatcacgaagatgatagacaagtttgtaaatggatcgaagagaattactctacatta
gaagaaagatttaaaggtatgaagttggaatcatttgcccaagatttagctaagagtatt
agaaatgatcatgatgttgcaattactggattatctgaagtactaaagatgttatctact
gaggataaagaaaaaatattaaagaatctaaagtaa

DBGET integrated database retrieval system