KEGG   Vanderwaltozyma polyspora: Kpol_1018p93Help
Entry
Kpol_1018p93      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Kpol_1018p93
Peptidases [BR:vpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Kpol_1018p93
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 755 aa AA seqDB search
MKLKRWLSISSSSRSKYSSKESLPENTSTAENTPRNSSNRQRNRRLSLNEPFLKLDLNNS
KISVHNTLSFTNNEELHSTEYPVTSADESNDEFVEAHETVPMQNDIDDQMQELNNQLGRI
DSSTKVFGFENFGNTCYCNSVLQCLYNFSELRDNLILYPEEAKFDPEQFDNSISIKNVIG
DEENQGIYYNNSSNKNSSSKLNILKSNNASCSHDQLNLNSVSSAKSKSNVKRNKDNNYMY
LTTNSTSASLVTISSSNSLQENENENESSGNLQSSGHEHAVKEQIDTSKLIIVGRPQVAK
SKSTMTLNTHSYQGRELNAINEPENNHENTENNHTFTNSKQNLIDTNISKDNETNDHNTC
ITIEERKKNALARGPVINIDRLLNQASESNMYNGLKDIFLTIKGNRYLTGVVSPSELIEI
LKKENVLFDTGMHQDAHEFLNFLLNELSEYIDRSNLKIEETEKTENFIKNIFQGTLTNKI
RCLTCDNVTSRDEPFLDLPIEVKSRNETDIKKALSNYHQREMLNGSNKFYCDGCCGLQEA
ERIVGIKHLPKILSLHLKRFKYSEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSG
IIIHLGAGPQHGHYVAMCKTEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAYILFYK
TIETQDSDMENNGDEINLDNKTEPIDQYEKNLQQFISDDELLRSSEIRSKELMEQRTLNE
VEPDNEILDNRVKRSSFSSKSIKRTSKLFGFKRKQ
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaacgatggttgtctattagtagttctagtaggtcgaaatacagttcaaag
gaaagcttacctgagaatactagtactgctgaaaatacccctagaaactccagtaacaga
caaagaaatagaagattatcactaaatgaaccatttttgaaattggatcttaataattcc
aagataagtgttcacaacactttatcgtttaccaataatgaagaattgcattctactgaa
tatcctgtaacttctgcagatgaaagcaatgatgaattcgtagaggctcatgaaactgta
cctatgcagaatgatattgatgatcaaatgcaagagttgaataatcaattaggaaggatt
gatagctcaactaaagttttcggttttgagaattttggcaatacctgttattgtaattca
gtgttacagtgcttatacaatttctctgagttgagggataatttgattttatatcctgaa
gaggcaaaatttgatcctgaacagttcgataattctattagtattaaaaatgtaataggt
gatgaagaaaatcaagggatttattataataattcttcaaacaagaatagttccagtaaa
ttgaatattctgaaatcaaataatgcttcatgttcgcatgaccaacttaatttgaattct
gtatcatctgcgaaaagtaaatcgaatgtaaaaaggaataaggacaataattacatgtac
ttaactactaattctacatctgcatcgttagtaacaatatcatcttctaattctttgcaa
gaaaatgaaaatgaaaatgaatccagtggtaatttacaaagttcaggtcatgaacatgca
gtcaaagaacaaattgacacttcaaaacttattattgttggaagacctcaagtggctaaa
tcaaaatcaactatgacattaaatactcatagttatcaaggtcgggaattaaacgctata
aatgaaccagagaataatcatgaaaatacagaaaataatcatacatttacgaactctaaa
caaaatctaattgatacaaacatttctaaagataacgaaactaatgatcataacacttgt
attactattgaagaaaggaaaaaaaatgctctcgcaagaggacctgtaataaacattgat
cgattgcttaaccaagcgagtgaatctaatatgtataatggattaaaggacatattttta
acaattaagggtaacagatatctaacaggagtagtatcgccatccgaattaattgaaatt
ttaaagaaagaaaatgtattatttgatacaggaatgcaccaagatgctcacgaattctta
aactttcttcttaatgaattaagtgaatatatagatagatccaatttaaagatagaagaa
actgaaaaaactgaaaattttattaagaatatatttcagggtactctaactaataagatt
agatgtttaacatgtgataatgtaacttcgagggatgagcctttcttagatcttccgatt
gaagttaaatcaaggaatgaaactgatattaagaaagctctgtcaaattatcatcaaaga
gaaatgttgaatggatctaacaaattttattgtgatggttgctgtggattacaagaagct
gaaagaattgttggtataaagcacttgccaaaaatcctttccttacatttaaagagattt
aaatattcagaagaaaacaatgcaaatattaaattattcaataaaattacatacccatct
gaattgcatgtacgttctacgttcgatcgtagtatctccaagaaatatgagttaagtggt
attattatccaccttggagctgggccacaacatggacattacgtagcaatgtgtaaaact
gaaaagtttggatggttattatatgatgatgaaactgtagaagcagttcttgaaaaggat
gtattaaggcatgttggtgacagtaatgatctggcaacggcttacattttgttttataaa
acaattgaaacgcaggatagcgatatggaaaataatggtgatgaaataaatttagataat
aaaacagaacctattgatcaatacgaaaaaaatctacagcaattcattagtgatgatgaa
cttcttagaagttcggaaattcgtagtaaagaattaatggaacagaggacacttaatgag
gttgaaccagataatgaaattctagataacagggttaaaagaagttcattctctagtaaa
tccataaaacgtacatctaagttgtttggattcaaaagaaagcaataa

DBGET integrated database retrieval system