KEGG   Vanderwaltozyma polyspora: Kpol_1023p35Help
Entry
Kpol_1023p35      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:vpo00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 668 aa AA seqDB search
MEKSGKASAADKVSNNSIKDNGLRKGPFREYFPIDYNDIKGTGKFLPYYLDFIIGLFISG
FYFYRSYPQLNYQSQEILESENQILLAIRHYKNGEFYLGPYAPFGIQLFSLLPNDISVLR
VASLSIGASTVFFSYLGARRANMTSLVSIIFSLSLTYMSIFKVQSTQLSIDNLFWLYLTM
IIYSWRSIKIYNPFSTKWYLHYVLLSFSLGSIISTKFLGFFTLLWIISLSALNFWNIISD
VTLNNKFLIKYLLFCSTMVLIIPVTFFVGSESMLLTSWKNDNIEYSTYMSPEFKSYLRGP
FKVTENLHFGSVITLRHVESMGGYLHSHNFNYESGSGEQQVSLSQNETDKQNEWIIEHES
AGFDVSSRNVVIENGSKIRLRHKSSGKLLRASTAKPPVSEQDYTNEVSCTRDEDYKGETD
ELWTIHITNYQTDGKVKPLGSIIKIRNVGHACDLISHDTRLPSEKFTEQEVLCLDPATQS
RTHFRIEKVSQPNREGTKMVFFPDENSMNMPYYIHLLTEYLSKQYKYNYYVVNYNQKAEY
TPESWPFFVFDKKFESYIWLSSTLGLGLFVCGQLISFLRWNPYESGDISVQQNSDPIFAE
ICYEYLLGWILHYYPFNKSVVMNLDIILYFPGFYFGLLLLAKYMDGIYKWNRLSILVPVA
YVVYIHFY
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcaggtaaggcatctgctgcagataaggtgtctaacaacagtataaaggac
aatggtttaaggaaaggtccatttagagaatacttcccaatcgactacaatgatattaaa
ggtactggtaaatttttaccatattatctagattttattattggattattcattagtggg
ttttatttttataggtcatatccacaattgaattatcaatctcaggagattttagaatca
gagaatcaaatactgttagcgataagacattacaagaatggcgaattttacttaggtcct
tatgcaccatttggaattcaattattttcattattaccaaatgatatatcagtattgagg
gttgcttctctttccattggtgcttcaacggtttttttcagttatttaggagcaagaagg
gcaaatatgactagtttggtatcgattatattttcattatcacttacctatatgtctatt
ttcaaagttcaatcaactcaattgtcaatcgacaatttgttctggttatatttgactatg
attatctattcttggagaagtatcaaaatttataacccattttctaccaaatggtattta
cattatgttcttctatcattttcattgggctcaataatatcaacgaaatttttagggttt
ttcactctgctttggatcatatcattatctgccttaaatttctggaatataatttctgac
gttactttgaacaataaattcttgatcaagtatctattattttgctccacaatggttttg
ataataccagttacattttttgttggatcggaatcaatgctgctaacaagttggaaaaat
gataacatcgaatactcaacttacatgtcaccagaattcaaatcctatttaagaggacca
tttaaagttaccgagaatcttcatttcggctctgttattacattgcgtcatgtagaatct
atgggaggatatttgcattcacacaatttcaattatgaatctggatcaggtgaacaacaa
gtatccttatcacagaatgaaactgataaacaaaatgaatggataattgaacacgaatct
gcaggttttgatgtatctagccgcaatgtcgtaatagaaaatggtagcaagatcagactg
agacacaagagttctggtaaattattacgtgcttcaactgcgaaaccacctgtcagtgaa
caagattatactaatgaagtttcatgtactcgtgatgaggattataagggagagaccgat
gaattatggactattcatatcactaattatcagacagatgggaaagttaagccattgggg
tcaattataaaaattagaaatgtaggccatgcctgcgatttgatcagccatgatactcgc
ttacctagtgaaaaattcactgaacaggaagtactatgtttagatccagcaacacaatct
agaacccacttcagaattgagaaggtatctcagccaaatagagagggtaccaaaatggtg
ttttttccagatgagaatagtatgaacatgccatactatattcatttattaacagagtac
ttgtccaaacaatataaatataattattatgtggtaaactataatcaaaaagcagaatac
accccagaaagctggccatttttcgtttttgacaagaaattcgagtcatacatctggtta
tcatccactttaggtcttgggttatttgtttgcggtcaattgatttcatttttaagatgg
aacccatacgaatctggtgacatatctgtgcaacaaaattcagatccaatatttgctgaa
atttgttatgaatacctattgggttggattttacattactatccgttcaataaaagtgta
gtaatgaacttagatattatcctttatttcccaggattttattttggattacttctgtta
gcaaaatatatggatggaatttacaaatggaacagattatcaattctagtccctgtagca
tatgttgtatacatacacttttactga

DBGET integrated database retrieval system