KEGG   Vanderwaltozyma polyspora: Kpol_1023p45Help
Entry
Kpol_1023p45      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vpo00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 441 aa AA seqDB search
MLEEQGFESQDKENMPNTYTIVIKVGSSSLVDEQTKEPKLAIMSKLVETVVRLRRAGHKV
AIVSSGGIAVGLRALGLPKKPKHISEIQAIAAVGQGRLIGRWDLLFSQFNQRIAQVLLTR
TDIMYWRQYRNAQNTLNELLKMGVVPIINENDTLSISEIKFGDNDTLSAITASIVGADYL
FLLTDVDCLYTDNPRTNPDATPILIVPDISKGLPGVKIDSGGGSSVGTGGMETKLVAADL
ATNAGVHTIVMKSDVPENINKIVDYIQSLDINLSGNGEKKIEEENGCDLFELQRKELERL
EEMEVPLHTKFLANDDNHHLKNREFWILHGLVANGAVIIDEGAYKALTRRNKAGLLPAGV
IEVEGSFHELECVELKIGKRLPNGELDTSIPLRTCGKARCDYSSIEISRIKGLQSDEIEN
ELGYADSEYVAQRENMAFPPN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagagcaggggtttgaaagtcaagacaaagaaaatatgccaaatacatatact
attgttattaaagtaggttcctcatcgttagtcgatgagcagactaaggagcctaagttg
gctattatgtctaaattagttgagactgtagttagactgagacgggctggtcataaagtt
gctattgtttctagtggtggtattgctgttgggttgagggcattaggtttgcctaaaaag
cctaaacacatatctgagattcaggctatcgcagctgtgggtcaaggtagattgattggt
agatgggatttattattttcccagttcaatcaaagaattgcccaagttttattaactaga
actgatataatgtattggagacagtatagaaatgctcaaaatacattaaatgagttgttg
aagatgggtgttgttccaattattaatgagaacgataccttatctattagtgaaattaaa
tttggtgataatgatacattatctgccattacagcatcaatcgttggggctgactattta
ttccttttgactgatgtcgactgtttatatactgataatccaagaaccaatccggatgct
actccaatcttaattgttccagatatttcaaaagggttgccaggtgtgaagattgacagc
ggtggtggctcttcagtcggtactggtggtatggagactaagttagttgccgctgattta
gctaccaatgctggtgttcatacaatcgtgatgaagagtgatgttcctgaaaatattaac
aagattgtggattatattcaaagtcttgatataaacttaagcggtaatggtgaaaagaaa
attgaagaagaaaatggttgtgatttatttgaattacagaggaaagaattggaaagattg
gaagagatggaggttcctttacatacgaaatttttagccaatgacgacaaccatcatttg
aagaatcgtgagttttggattcttcatggcttagtagcgaacggtgctgttattatcgat
gaaggtgcatataaagcattgacacgtagaaacaaagccggtttattaccagcaggtgtt
attgaagttgaaggttcattccacgaattagaatgtgttgaattgaaaattggtaagagg
ttaccaaatggtgagttagacacatcgattccattacgtacatgtggtaaagctcgttgt
gattattcaagtattgaaattagcagaattaaaggtttgcaaagtgatgaaattgaaaat
gaattagggtacgccgacagtgaatatgttgctcaaagagaaaacatggctttcccacca
aattga

DBGET integrated database retrieval system