KEGG   Vanderwaltozyma polyspora: Kpol_1024p28Help
Entry
Kpol_1024p28      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Kpol_1024p28
Transfer RNA biogenesis [BR:vpo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Kpol_1024p28
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 559 aa AA seqDB search
MGRSGGKGPRNNKGQNLAPEKERFIQCCTDVTLELTNSLTAGTTREINLNGLITKYSKKY
KLKQQPRLTDIINAIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNIC
VYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSIDKVEYIV
MGGTFMSLPKDYREDFIVKLHNALSGFNGTDIDEVIQYSQQSLTKCVGITIETRPDYCTP
THLDDMLKYGCTRLEIGVQSIYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDL
PNVGMERDIEQFKEYFENPEFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLV
ARIMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTTSRDIRTREVGIQ
EVHHKVQPDQVELIRRDYYANGGWETFLAYEDPKKDILIGLLRLRKASKKYTYRKEFTSQ
RTSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERISREEHGSEKISVISGVGVR
NYYAKLGYELDGPYMSKQL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgttctggtggtaaaggtcctagaaataacaaaggccagaatttggctcctgag
aaggaacgttttatccagtgttgtaccgatgtaactttagaattgactaattctttgact
gcaggtaccactagagaaattaatctaaatggtttaattactaaatattcgaaaaaatat
aaactaaaacagcaaccaagattgaccgatatcatcaatgctatccctgatcagtacaag
aaatacctattaccaaaattaaaggcaaaacctgttagaactgcttccggtatcgcggtt
gtagcagtcatgtgtaaacctcatcgttgtccacatatagcttatactggtaacatttgt
gtttactgtcctggtggtccagattcggattttgaatattctacccaatcttatactggt
tatgagcctacgtcaatgcgtgcaatcagagctcgttacgatccttatgagcaggcccgt
ggtagaatcgaacaattgaaacaattgggtcattccatcgataaagtcgaatatatcgtc
atgggtggtactttcatgtctttgccaaaggactatcgtgaagattttatcgtaaaatta
cacaacgccttatcaggttttaatggtacagatatagatgaagttatacagtactcacaa
caaagtttaactaaatgtgttggtattacaatcgaaactagacctgattattgtactccg
acacatcttgatgatatgttgaaatacggttgtacaagattagaaatcggtgtccagtct
atttatgaagatgtcgctcgtgacaccaatagaggtcatacagtaaaagcggtatgtgaa
acttttgcagttgcaaaagatgctggttataaagtcgtctcacatatgatgcctgattta
ccaaatgttggcatggaaagagatatagagcaattcaaagagtatttcgaaaaccctgaa
ttcagaacagatggtttgaaaatctatcctactttggtcattagaggtacaggtttatat
gaactttggaagacaggaagatataagtcttacaacgcaaacgctttggtagatttagtc
gctagaatcatggctttggttcctccttggacaagaatttaccgtgttcaaagagatatt
ccaatgccactagttacttccggtgtcgacaacggtaacttaagagaattagcactggca
agaatgaaagattttggtacaacctctcgtgatattcgtacaagagaagttggtatccag
gaagtccatcataaagtccaacccgatcaagttgaattgatcagaagagattattatgca
aatggtggttgggaaacatttttggcctatgaagatccaaagaaggacatcttaattggt
ctattgagattgagaaaagcttcaaagaaatatacttatagaaaggaatttacttcacaa
agaacttctattgttagagaattgcatgtttacggttccgtagtgccattgcattctaga
gatccacgtaaatttcaacatcaagggtttggtacattgttaatggaggaagcagaaaga
atttcccgtgaagaacatggttctgagaaaatttctgtcatttctggggttggtgtcaga
aattattatgctaaattaggatacgaattagatggtccatatatgtccaagcaactataa

DBGET integrated database retrieval system