KEGG   Vanderwaltozyma polyspora: Kpol_1024p44Help
Entry
Kpol_1024p44      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 496 aa AA seqDB search
MVTLSDKLNGVWINFVHVFQKNPLKSLSYTVASSILVYLITPSIFNLVFRKSVSNERSER
KDKYTTGLVNTSTECYANSSVQVLASLSNFTIYLNKVISIFELELKIEKVEKDAKEAFDT
YLYKVIPVHYALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQQDANELTQIV
LEVLQNELESLKKYVNRMELSIEVPRFPFEGKLASYLSCLNCGQTSIPNISTFNILPIQT
PQEYSAELEEIIYGNQIDQITDYSCLVCQTNAILKNEKTNGHKGNTTDEHEIVKYLEDVL
PVLRINEELDSKTLNYIKYYNKYGMKSGNIKSTIIKKNSIIETPKILMIHLSRSIYNGMV
AVRNSCRVRFEEKMSIERQTTDEKNENLKIELVDYQLQSIIKHTGTHNSGHYQCYRRKPN
LKRNITTKEIINFSPVISPVISSSSLQNSKKDNRKLKSINKYPFWKISDTKINESTLDNV
TDKQKSVYILFYEMIT
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttacactgtctgataagttgaatggagtttggatcaactttgttcatgttttccaa
aagaacccactaaaaagtttgtcatatacagttgcctcatcgattttagtatatctcatt
acaccttctatatttaatttggtatttcgaaaatcagtttctaatgaaagaagtgaaagg
aaggacaagtacacaactggcttggtgaatacaagcacagaatgttatgccaattcatct
gtccaagttctggcatcattatctaactttaccatatacttgaacaaagttatctctata
ttcgaacttgaattgaagattgaaaaggttgaaaaggatgccaaggaagcttttgacacc
tacctatacaaggtcatcccagttcattacgcattatgtcaattgttagcagatctccaa
gaacttatagatagacctagggagagatctgtttcaaatttcattaggatattagaggcc
agtatccacaagagaattactggagggcaacaagatgctaacgaattgactcaaatagtc
ctcgaagtactacagaatgaattagagagtttaaaaaaatatgtcaatagaatggaactt
tcaattgaagttcctcgtttcccctttgaggggaaacttgcaagttacctgagttgttta
aattgtggtcaaacttcaatacctaatatatctacatttaatatattaccaattcaaacc
ccacaagaatattcagctgaactagaagaaatcatatatgggaatcaaattgatcaaatt
accgattactcatgtctagtatgccaaacgaatgcaattttaaagaacgaaaaaacaaat
ggacacaaagggaataccactgatgagcatgaaattgttaaatatttggaagatgttcta
cctgtacttaggataaatgaagagttagattccaagacattaaattacatcaaatattat
aataaatatggaatgaaaagtgggaatatcaagagcacaattattaaaaaaaattcaata
attgaaacgcccaagattttaatgattcatttatctagatcaatttataatggtatggtt
gcagttaggaattcatgtagggttcgatttgaagagaaaatgtcaattgaaagacaaacg
actgatgaaaaaaacgagaatttaaaaattgaactagttgattaccaattacaaagcata
ataaaacacacagggacacataattcaggacattatcaatgttaccgtaggaaaccaaat
ctaaaaagaaatattaccaccaaagaaataatcaacttttcaccagtgatctcaccagtg
atctcatcgtcatcactacaaaattcaaaaaaggataacaggaaattgaaaagcatcaat
aaatacccattttggaagatatcagataccaaaataaacgaatctactctggataacgtc
actgataaacaaaaatcagtatacattttattttacgaaatgattacataa

DBGET integrated database retrieval system