KEGG   Vanderwaltozyma polyspora: Kpol_1025p51Help
Entry
Kpol_1025p51      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kpol_1025p51
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kpol_1025p51
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kpol_1025p51
Enzymes [BR:vpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kpol_1025p51
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 707 aa AA seqDB search
MSELLRQTFAQAKKEGRNALVTFMTAGYPTVEDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNSVALENGVTLKQTLDLVRQARAEGITIPIILMGYYNPLLNYGEEKFIKDAA
EAGTNGFIIVDLPPEEALKIRGYVRENGLSLVPLVAPSTTDERLELLSHIADSFVYVVSR
MGTTGVQTSVSNDLGELVARVRKYTKDIPLAVGFGVSTREHFETVGSSSDGVVIGSKIVT
LCAEAPTGKRYDTAKTYVEGILNGVKHKILTKDEFNSLHEKSINNAKALNDIANEFDEKH
KFSDRFGEFGGQYVPEALHACLRELEQGFEEASADPKFWEDFKSLYSYIGRPSSLHRAER
LSEYCGGAQIWLKREDLNHTGSHKINNALAQVLLAKRLGKTNVIAETGAGQHGVATATAC
AKFGLSCTVYMGAEDVRRQALNVFRMRILGAKVIAVTNGTKTLRDATSEAFRSWVTNLET
TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFASMNNGKLPDAIVACVGGGSNSTGMFS
PFEHDTSVKLLGVEAGGDGIDTEFHSATLTAGRPGVFHGVKTYVLQDSDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRAEFVAATDAQALEGFKLLSQLEGIIPALESSHAVYGAVQLA
KTMKPDQHLIINISGRGDKDVQSVAEVLPKLGPKIGWDLRFEADPSV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattattgagacaaacttttgctcaagctaaaaaagaaggccgtaatgcattg
gtaacctttatgactgctggttacccaaccgtcgaagatactataccaattttgaaaggt
ttccaagacggtggtgtagatgttatcgaattgggtatgccattctctgacccaattgca
gacggtccaactattcaggtttctaattctgttgctttggaaaacggtgtcaccttaaag
cagactcttgatttagttcgtcaagcaagagctgaaggtatcactatcccaattatttta
atgggttattataatcctcttttgaattatggtgaagaaaaatttattaaagatgctgct
gaagcgggtacaaatggtttcatcattgtcgaccttcctcctgaagaagctctgaaaatt
agaggttatgttagagaaaatggtttaagtttagtaccactggttgctccttctactact
gatgaaagattagaactattatctcatatagctgattctttcgtttatgttgtttcaaga
atgggtaccaccggtgttcaaacatcagtttccaatgatttgggtgaattagtcgctcgt
gttagaaaatatactaaggatattccattggcagtaggttttggtgtgtcaactagagaa
cattttgaaactgtaggttcatcttccgatggtgtagtcatcggttctaaaatcgttact
ctatgtgcggaagctccaacaggcaaacgttatgacactgctaaaacatacgttgaaggt
attctaaatggtgttaaacataagattttaactaaggatgagtttaatagtttacacgaa
aagtctatcaataatgccaaagccttgaacgatattgctaatgaatttgacgaaaaacat
aaattctcagacagatttggtgaattcggtggtcaatacgttcctgaagctttacatgca
tgtctaagagaattagaacaaggttttgaagaagcaagtgctgatccaaagttctgggaa
gattttaaatctctatattcctacattggccgtccttcttctttgcacagagctgaaaga
ttatctgaatattgtgggggtgcccaaatttggttaaagagagaagatttaaaccatact
ggttctcacaaaattaacaacgctttggctcaagtattgttggctaaaagattgggtaag
accaacgtcatcgctgaaaccggtgctggacaacacggtgtagctactgctaccgcttgt
gccaaattcggtctatcatgtacagtttatatgggtgctgaagatgttcgtcgtcaagct
ttaaatgttttcagaatgagaattttaggtgccaaagttattgctgtcactaacggtacc
aaaactttaagagatgctacatctgaagcttttagatcatgggtcaccaatttggaaact
acttactacgtagttggttctgctattggtcctcatccatacccaacattagttcgtact
ttccaaagtgttattggtaaggaaactaaggagcaatttgcttccatgaacaatggtaaa
ttaccagatgccattgttgcttgtgttggtggtggttctaattctacaggtatgttctct
ccttttgaacatgataccagtgtcaagcttctgggtgttgaagctggtggtgatggtatt
gacacggaattccattctgctactttaactgcaggtagacctggtgttttccacggtgtc
aagacatatgtcttacaagacagtgatggtcaagttcacgacacccactcagtttcagct
ggtttagattacccaggggttggtccagaattggcatactggaaatctactggccgtgct
gaattcgttgctgcaactgatgcccaagctctagaaggtttcaagttgttatctcaattg
gaaggtatcattccagctctagagtcatcacatgcagtgtatggtgcagttcaattggct
aaaaccatgaaaccagatcaacacttaataatcaacatctctggtagaggtgataaagat
gtacagagtgttgctgaagttttaccaaaattaggtcctaagatcggttgggatttaaga
tttgaagcagacccttcagtataa

DBGET integrated database retrieval system