KEGG   Vanderwaltozyma polyspora: Kpol_1025p51Help
Entry
Kpol_1025p51      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vpo00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vpo00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 707 aa AA seqDB search
MSELLRQTFAQAKKEGRNALVTFMTAGYPTVEDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNSVALENGVTLKQTLDLVRQARAEGITIPIILMGYYNPLLNYGEEKFIKDAA
EAGTNGFIIVDLPPEEALKIRGYVRENGLSLVPLVAPSTTDERLELLSHIADSFVYVVSR
MGTTGVQTSVSNDLGELVARVRKYTKDIPLAVGFGVSTREHFETVGSSSDGVVIGSKIVT
LCAEAPTGKRYDTAKTYVEGILNGVKHKILTKDEFNSLHEKSINNAKALNDIANEFDEKH
KFSDRFGEFGGQYVPEALHACLRELEQGFEEASADPKFWEDFKSLYSYIGRPSSLHRAER
LSEYCGGAQIWLKREDLNHTGSHKINNALAQVLLAKRLGKTNVIAETGAGQHGVATATAC
AKFGLSCTVYMGAEDVRRQALNVFRMRILGAKVIAVTNGTKTLRDATSEAFRSWVTNLET
TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFASMNNGKLPDAIVACVGGGSNSTGMFS
PFEHDTSVKLLGVEAGGDGIDTEFHSATLTAGRPGVFHGVKTYVLQDSDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRAEFVAATDAQALEGFKLLSQLEGIIPALESSHAVYGAVQLA
KTMKPDQHLIINISGRGDKDVQSVAEVLPKLGPKIGWDLRFEADPSV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattattgagacaaacttttgctcaagctaaaaaagaaggccgtaatgcattg
gtaacctttatgactgctggttacccaaccgtcgaagatactataccaattttgaaaggt
ttccaagacggtggtgtagatgttatcgaattgggtatgccattctctgacccaattgca
gacggtccaactattcaggtttctaattctgttgctttggaaaacggtgtcaccttaaag
cagactcttgatttagttcgtcaagcaagagctgaaggtatcactatcccaattatttta
atgggttattataatcctcttttgaattatggtgaagaaaaatttattaaagatgctgct
gaagcgggtacaaatggtttcatcattgtcgaccttcctcctgaagaagctctgaaaatt
agaggttatgttagagaaaatggtttaagtttagtaccactggttgctccttctactact
gatgaaagattagaactattatctcatatagctgattctttcgtttatgttgtttcaaga
atgggtaccaccggtgttcaaacatcagtttccaatgatttgggtgaattagtcgctcgt
gttagaaaatatactaaggatattccattggcagtaggttttggtgtgtcaactagagaa
cattttgaaactgtaggttcatcttccgatggtgtagtcatcggttctaaaatcgttact
ctatgtgcggaagctccaacaggcaaacgttatgacactgctaaaacatacgttgaaggt
attctaaatggtgttaaacataagattttaactaaggatgagtttaatagtttacacgaa
aagtctatcaataatgccaaagccttgaacgatattgctaatgaatttgacgaaaaacat
aaattctcagacagatttggtgaattcggtggtcaatacgttcctgaagctttacatgca
tgtctaagagaattagaacaaggttttgaagaagcaagtgctgatccaaagttctgggaa
gattttaaatctctatattcctacattggccgtccttcttctttgcacagagctgaaaga
ttatctgaatattgtgggggtgcccaaatttggttaaagagagaagatttaaaccatact
ggttctcacaaaattaacaacgctttggctcaagtattgttggctaaaagattgggtaag
accaacgtcatcgctgaaaccggtgctggacaacacggtgtagctactgctaccgcttgt
gccaaattcggtctatcatgtacagtttatatgggtgctgaagatgttcgtcgtcaagct
ttaaatgttttcagaatgagaattttaggtgccaaagttattgctgtcactaacggtacc
aaaactttaagagatgctacatctgaagcttttagatcatgggtcaccaatttggaaact
acttactacgtagttggttctgctattggtcctcatccatacccaacattagttcgtact
ttccaaagtgttattggtaaggaaactaaggagcaatttgcttccatgaacaatggtaaa
ttaccagatgccattgttgcttgtgttggtggtggttctaattctacaggtatgttctct
ccttttgaacatgataccagtgtcaagcttctgggtgttgaagctggtggtgatggtatt
gacacggaattccattctgctactttaactgcaggtagacctggtgttttccacggtgtc
aagacatatgtcttacaagacagtgatggtcaagttcacgacacccactcagtttcagct
ggtttagattacccaggggttggtccagaattggcatactggaaatctactggccgtgct
gaattcgttgctgcaactgatgcccaagctctagaaggtttcaagttgttatctcaattg
gaaggtatcattccagctctagagtcatcacatgcagtgtatggtgcagttcaattggct
aaaaccatgaaaccagatcaacacttaataatcaacatctctggtagaggtgataaagat
gtacagagtgttgctgaagttttaccaaaattaggtcctaagatcggttgggatttaaga
tttgaagcagacccttcagtataa

DBGET integrated database retrieval system