KEGG   Vanderwaltozyma polyspora: Kpol_1027p1Help
Entry
Kpol_1027p1       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Kpol_1027p1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
AGAAPGTHTTTSTTTTTTTTTSNPNNIDGNIVNSLIDESVVLDDDDDDDDEDLEELSTTN
IFHSDHQFLYSKDPSHHPLIVNGARYKYKKQRTISLPQLPYAKLLYNTTIIDQHSNEGHY
TYRGGATQNDDELLNLTGNSNITLDSNKLVDLTVIRSLSPTVTSDYSSHPIKRRLSSITK
YHRLHHHTSSSTSASSSSHSSSRNESHFQTDKDGHYVYKANDIFCDGRFIVKELLGQGTF
GKVLKCKDNLDSGNLVAVKVIKAIERYREAAKTELRILQTIHDNDPLGNYQCILLNECFD
YKNHICLVTNLYGKSIYDFMCSNAIARFPGSQVQAIARQLIRSVCFLHDLGIIHTDLKPE
NILLVDDSHYISKQLPKEKLSSLSLRRKNASNGGIHKILVNPEIKIIDFGSAIFYNEYHP
PIISTRHYRAPEIILGLGWSYPCDVWSIACVLVELVTGESLYPIHENLEHLAMMQRINGQ
QLPKKIVEKMFYKVTHKLGNLPADLNTTVVRHFDRKSLTLQWPEVNKNGDMVTTEKSMKR
VRDSCDRLDLHISRKISTDFFGDNSLTINWNLSPEQNWNLIRQKLSSYNSHYPNSSSTPN
SPNNSLSSSPQNYYYPNSSNINSNGLSSFSSSQNSDKVPLDKETFLFWYWFVDLLKKMFE
FDPTKRITAKEALDHEWFNLGILDDGISSFENFLA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
gctggcgcagctcctggtacacataccaccacttccaccactactacaactacaactacc
acttctaatccaaataatatcgatggaaacatcgtaaactcattgatagatgaaagcgtg
gtactggatgacgacgacgacgacgatgacgaagatctagaagaactatcaactacaaat
atattccattcagaccaccagtttctttactcaaaagacccctctcatcaccctttgata
gtcaacggagcaagatataaatataaaaaacaaagaaccatctctttgccacaattgcca
tatgcaaaattactatacaatactactataatagatcaacactcaaatgaaggccattac
acctatagaggtggtgccactcagaacgatgacgaactattgaatttaactggaaattca
aatataaccctggattcaaataaattagtagacttgacagttataagatcactctcgcca
actgtcacctcagactactcttctcaccctatcaagagaagactatcttcaataaccaaa
taccacagactgcatcatcacacttcttcttccacaagcgcatcttcttcaagccacagc
tcttctcgtaacgagtctcacttccaaactgataaagacggccactatgtgtacaaagca
aatgatatcttttgtgatggtagattcatcgtaaaggaactactaggccaaggaaccttt
ggaaaagtactcaaatgcaaagacaatctagattctggaaatctagtcgccgtgaaagta
ataaaagcaatcgagagatatagagaagctgcaaaaactgagctgagaattttacaaact
attcatgataatgatccattaggaaattatcaatgtattctattgaatgagtgcttcgat
tacaagaatcacatctgtttagtgacaaacttatacggcaagtccatttatgatttcatg
tgttctaacgccatcgcaaggttccctgggtctcaagtacaagcaattgcaagacagctc
ataagatcggtctgcttcttacatgatttaggaataatccatacagacctaaagccagaa
aatattctcttggtagatgattctcactatatctcaaagcaattaccaaaggaaaaatta
tcttctctaagtttaagaaggaagaatgcaagtaatggcggtattcataaaattttagtc
aatccagaaattaaaattatagattttggttcagctattttttataacgaataccaccct
ccaatcatatctaccagacattacagggccccagagattatcttgggtttaggctggtct
tacccctgtgacgtttggtcaatagcatgtgtactggtagaattggttactggtgaatca
ttatacccaatacacgaaaatttagaacacttagctatgatgcaaagaattaatggtcaa
caattaccaaagaaaattgtggagaaaatgttttataaagttacgcataaattaggcaac
ttgcctgcagatttaaataccactgtcgtaaggcatttcgacaggaaaagcttaacatta
caatggccagaagttaataaaaatggtgatatggtgactacagaaaaatcgatgaaaaga
gtaagagattcttgtgatagactggatctacacatctcaagaaaaatatccaccgatttc
tttggggacaattcccttacaattaactggaatctatcgccagaacagaattggaattta
ataaggcaaaagttatcaagttataactcacactacccaaattcatcttcgacaccaaat
tctccaaataattccttatcatcttctccacaaaattactactatccaaattcttctaac
attaactctaacggactaagctcattctcttcaagtcaaaattcagataaagttcctcta
gacaaagaaacgttcttgttttggtactggttcgttgatttgttgaaaaaaatgttcgaa
ttcgatcctactaaaagaataactgcaaaagaagcattggatcatgaatggttcaactta
ggtattttagatgacggtatttcaagttttgaaaactttttagcataa

DBGET integrated database retrieval system