KEGG   Vanderwaltozyma polyspora: Kpol_1031p52Help
Entry
Kpol_1031p52      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
vpo  Vanderwaltozyma polyspora
Brite
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Kpol_1031p52
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MSSASKAPASKAPAEKKPAAKKTSTSTDGKKRTKARKETYSSYIYKVLKQTHPDTGISQK
AMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRA
VTKYSSSTQA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgcttctaaggccccagcatctaaagccccagctgaaaagaaaccagctgcc
aagaaaacttctacttctactgatggtaagaagagaactaaggctagaaaggaaacttac
tcttcctacatttacaaagttttgaaacaaactcacccagacactggtatttctcaaaag
gctatgtctattttgaactcttttgttaacgatatttttgaaagaatcgctactgaagct
tccaaattagctgcttacaacaaaaaatctaccatctctgctagagaaatccaaactgct
gttagattgatcttaccaggtgaattggctaaacatgctgtctctgaaggtaccagagct
gttaccaaatactcttcctctactcaagcttag

DBGET integrated database retrieval system