KEGG   Vanderwaltozyma polyspora: Kpol_1032p10Help
Entry
Kpol_1032p10      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    Kpol_1032p10
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Kpol_1032p10
Protein kinases [BR:vpo01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Kpol_1032p10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 791 aa AA seqDB search
MGNNLMYKPTSIDIHKNQDLKLNSKYSRNEGMIEGNDNNKNIQDDSDDEQITGFPKLSNF
GSALLTSEKENITKNKLTNTNLTLNDDKSLAYDNYSSTLSINRAGNVNTTSSMSKANNNY
EYNNSSENISTGNSTFQRFKGLHESIKDELNTKNLERRKTRRFFNRTKMGVLGPAMRTNL
ENEKLGKNSKHETIEEKINKYDQPAHLISSSSTVASSSYTSYHDTHQSINQTSQTTINYD
LIDFGELNPVQYIKKNNLPTTELPTISKLYFERQRAESRKIALKKHSSSKELLFSSSSSA
LKNSFNQISDAQNESKCISNNTGDTDALSEPKISDKENSRSTWSRNGYAILKDDYINNLE
YYKNPSGYSSSLNKKREALSSINVNTNHNHSYQELGDNKRNKISTKGIESEIEHVAARNS
MLEQQKVEQLNSANIHKHGKKKVEIIEPKSASANRIASKSVVSVNGVEYEKIELLGRGGS
SKVYKVKNVHNNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESG
VLLLIMECGDHDLSQILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFV
FVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSDQQNKWKVGK
PSDIWSCGCILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETM
KACLIRNPDKRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELAD
DVLNRLADFRL
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaatttaatgtataaaccaacatcaattgatatacataaaaatcaagatcta
aaattgaattcaaagtattctagaaatgagggtatgatagagggaaatgataataataaa
aatatacaagatgattcagacgatgaacaaataacaggatttccaaaattaagtaatttt
gggtctgcactattaacttctgaaaaggaaaacataacaaagaataaacttacaaacact
aatttaactctaaatgatgataagtccttagcatatgataattattcttctactttatct
atcaatcgggctggaaatgttaatactacttccagtatgagtaaagcaaataataattac
gaatataataatagtagtgagaatatttcaacggggaactcgacctttcaaaggtttaaa
ggcctccatgaatctatcaaggatgaattaaatactaaaaatctagaaagaaggaaaact
agacgattttttaataggacaaaaatgggtgtattgggtcctgcaatgaggaccaatcta
gagaatgaaaagctggggaagaactcaaaacatgagactattgaagaaaaaatcaataaa
tatgatcaaccagcacatttaatttcctcatcatctacagttgcatcctcttcgtatact
tcttatcatgatactcaccaaagtatcaaccaaacttcacagactacgataaattatgat
ttaatagattttggagaattaaatccagttcaatatattaaaaaaaataatctgccaact
acggaattacctacaatttcaaaattgtatttcgaaagacaaagggcggaaagtagaaaa
attgcattaaaaaaacattcatcatcgaaggaattattattttcttcatcatcttctgca
ttaaaaaattcattcaaccaaatatcagatgctcagaatgagagcaaatgtatatctaat
aacaccggggatacagatgctttgagtgaacccaagattagcgataaggaaaacagcagg
tctacatggagtagaaatggctacgctatcttgaaagatgattatataaataacttagaa
tactataaaaatccttcgggatatagtagctcactgaacaaaaaaagagaagcactatca
agcataaatgttaatacgaatcataatcatagctatcaagaacttggtgacaataagcgt
aataagatttcaacaaaaggtattgaatctgaaatagaacatgtagctgctaggaatagc
atgcttgaacaacagaaggtcgaacaactaaattcagctaatatacataaacatggtaag
aaaaaagtggaaataatcgaaccaaagtcagcatcagctaatagaatagcttcaaaaagt
gttgtatctgttaatggagtagagtatgaaaaaattgaacttttgggtagaggtggttct
tcaaaagtatacaaagttaaaaatgttcataacaacaagatttttgccttaaaacgagta
atgtttgatgagtttgatgagtctagtattgacagttttaaaggtgaaattgaacttcta
aaaaaattagaaaacgaaaagcgagttgttactctaattcaacatcaaatggaatctggt
gtattgctgttgatcatggaatgtggtgatcatgatttatcacagattctaaaccaaaga
atgaatatgccattggatattgagttcataaggtttcatgctagagaaatgttaaagtgt
gttaaagttgtccatgatgctggcatcgtgcattcagacctgaaacctgccaattttgta
tttgttaaaggaatccttaagattattgattttggtatagctaatgctgttccggaccat
actgtgaacatatatcgtgaaacccagataggcacacctaattatatggcacccgaagct
ctcgtggcaatgaatagccaacaagattcagatcagcaaaataagtggaaagtaggaaag
ccttccgatatatggtcatgtggttgtatcttatatcaaatgttttatggaaggcctcca
tatggatcttttcaaggtcaaaatagactgttagcaataatgaatcctaatgtaaaaatt
gttttctctgaaaaaacatccaacaatgagaggatacctcgatcagccctagaaacaatg
aaagcatgtcttataagaaatccagataagagatgggctgttgaccaagtattagaaggc
tcattcttcaaccctgttatggtaacttcgtttattattagggatttaattaaaaatgca
gtgaattatggtgccgaccagagatatgtgactgacgaaaaaatcacagagctagcagat
gatgttttaaatagattagcagattttagattgtag

DBGET integrated database retrieval system