KEGG   Vanderwaltozyma polyspora: Kpol_1032p12Help
Entry
Kpol_1032p12      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Kpol_1032p12
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Kpol_1032p12
Transfer RNA biogenesis [BR:vpo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Kpol_1032p12
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MLFEKELYVATEAVRKASLLTKRIQSQVIAHRESSTIIKSDSSPVTIGDYAAQTIIINAI
KTHFPNDKILGEETATGLEDKFVNEILTEIKNNDTVFDKEYKTDFEFTNSQFPLASIEDV
KKVINFGDYKGGRNGRFWCLDPIDGTKGFLRGEQFAVCLGLIVDGITQVGVIGCPNLSLS
SFGGKDKPNHEKFGYIFRSVRGFGAFYAAAASTSTSASTSNWTQIHSRKLSSTNEMISLE
GVEKGHSSHDEQAIIKERLGITRSLNLDSQAKYCLLALGLGDLYLRLPIKLSFQEKIYDH
AAGNVLVHEAGGIHTDAMENVELDFGNGLTLSTKGVIASCGPESLHGLAVKTSNEVINSR
IKSD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgagaaagaattatatgttgcaactgaagccgttcgtaaagcttctcttctt
actaagaggattcaatctcaagttatcgcccacagagagtcatctacaataattaaaagt
gatagttctcctgtaactattggtgattatgctgctcaaactattattatcaatgcaatc
aaaactcatttcccaaatgataagattttaggtgaagaaactgcaacagggttagaggat
aaatttgtcaatgagattttaacagaaatcaaaaacaatgatactgtatttgataaagaa
tataaaaccgatttcgaatttaccaattcccaatttccattggcaagtattgaagatgtt
aagaaagtgattaactttggtgattataaaggtggtagaaatggtaggttttggtgttta
gatccaattgatggtactaaaggatttttaagaggtgagcagttcgccgtatgtttagga
ttaatagttgatggaataacgcaggtaggtgttattggctgtcctaacctatcattatca
tcgttcggagggaaagataaaccaaaccatgaaaaatttggttatatatttcgttcagtc
agaggatttggagcattctatgcagcagcagcaagtacaagtaccagtgcaagtacaagt
aattggacacaaattcattcaagaaagctttctagtactaatgagatgatttcattagaa
ggtgtcgagaagggacattcatcacatgatgagcaagcaattatcaaagaaagattggga
attactagatcattaaaccttgattcccaagctaaatattgtttgttagccttgggatta
ggcgatttgtatttaagattacctattaagttaagctttcaagaaaaaatctatgaccat
gctgcaggtaatgttttagttcatgaagctggaggtattcatacggatgcgatggaaaat
gttgaattggattttggtaatgggttaacattgagcactaagggagtgattgcatcctgt
ggacccgaaagtttacatggattggcagttaagacatccaatgaagtgataaactctaga
atcaagagtgattaa

DBGET integrated database retrieval system