KEGG   Vanderwaltozyma polyspora: Kpol_1032p28Help
Entry
Kpol_1032p28      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Kpol_1032p28
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Kpol_1032p28
Peptidases [BR:vpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Kpol_1032p28
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 882 aa AA seqDB search
MVEVDSRKQLLYDPIVRLSGIADKFVMQDATSSNMKVSLQECIDTLANYQDECKKLKRNE
PTLSPSERYSIYESAYIYYKIIHIMVLTRIPSLPQFSSAKSSDATNEDKELMQIYNMLVK
TLLSDEKIAQIKSYLRANYPDKNSKGKESIVNKQLLNNEVFMLPLSGSPISAVQLNHLIQ
MYDSSLLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQKEIALF
QARDKYNYIVIYTQQSEKTQFYMHQQLVLLDILMNKSFAKPLNEKNIKVFTLDKGFSGWV
SKKGACETTTQNGDAIYISGNTSSLNLQNLPQLSPNIGSSMDKSMRDMMSTSADFEGRTY
QLPQQQQPVFARTPSFKNLFNKAKSSSTSSVTSSSPAPSQLVRPQTSSMPPLEQNFTQYP
ETPKLLTQINTNTMPLSQISPISSRAMSPMTKNMLTQSPQLPMKISRTTIGNGAMLDLKP
HPDSKPPGQPVPALPQLPHHMTGTYQNLNQPKLDLDFTVGLENMGNSCYMNCIIQCLLST
HELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHTMYREGSFKRPLEKNKPIQPIQF
KMACGSINSLFKDNTQQDSQEFCQFLLDGLHEDLNQCGANPPLKELSEDAEKMREKLSMR
IASSIEWERFLTTDFSVIVDLFQGQYASQLKCKVCGCTSTTYQTFSVLSVPVPHVSSCHI
LDCFNEFTKVEKLGTDELWSCPTCKKKQPSTKKLTITRLPRNLIIHLKRFDNMMNKNNVF
VKYPFLLDLTPYWANDFDGRLPPGVTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAY
VNKGINRGWHYFDDTSYRPIKNETECITPNAYVLFYHRVYGV
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtagattctagaaaacagttgctttatgaccctatcgttaggttatctggt
atagctgacaaatttgtaatgcaagatgctacttcttctaatatgaaagtttcattacaa
gagtgtattgatactcttgctaattatcaagatgaatgtaagaaattgaagagaaatgaa
cctactctatcgccgagtgaacgttactccatttacgaatctgcatacatttattacaaa
ataatacatataatggtattgacgaggataccaagcttgccacaattctcctctgcgaaa
agttcagatgcgacaaatgaggataaagaattgatgcaaatatataatatgcttgtgaaa
acgttgttgagcgatgagaagattgctcagatcaaatcgtatttaagggcaaattaccca
gataaaaatagcaaaggtaaggagagtatagttaataaacagttgttgaataacgaagtg
ttcatgctacctctatcgggttcccctatatcagctgtgcaattaaatcatttgattcaa
atgtacgacagttccttgttgttgatagatgtcagaccacgagcagaattcgatagtaaa
catataaaggccaaatctgtgatctgtgtagaacccgtttcttttaaaaattcattcact
gatttagaggtcgaaaagaaatcgttaattacttccccacaaaaggaaattgcattgttc
caagcaagggataaatataattatattgtcatttatacacagcaaagtgaaaagacacaa
ttttatatgcatcagcaactagtattactggatattctcatgaacaaatcttttgcaaaa
ccattaaacgaaaaaaatataaaagtattcacattggataagggattttcaggctgggtc
tcaaagaaaggtgcttgcgaaactaccacacaaaatggtgatgcaatttacatcagtggg
aatacttcaagcttgaatctacaaaatcttccacagctatcgccaaatattggttcctca
atggataagtcgatgagagatatgatgtctacttctgcagatttcgaaggaagaacttat
caattgccacaacaacagcaaccggtctttgcaagaacacctagttttaaaaatttgttt
aacaaggcaaaatcttcttctacttcatcagtaacttcatcctctcctgcgccctctcaa
ttagtcagacctcaaacatcgtcgatgcccccattagagcaaaattttactcaatatcca
gagacccctaagttattaactcaaataaataccaatacaatgccattgtctcagatatct
ccaattagttcaagagcaatgtcaccaatgaccaaaaatatgttaacgcaatcgccacag
ttaccaatgaaaataagcaggactacaattggtaatggtgctatgttagatttgaaacca
cacccagattcaaaacctccaggccaacctgttccagcattacctcagctcccgcatcat
atgacgggcacttaccaaaatctcaatcaaccaaagttagatctggattttactgttggt
ttagagaatatgggaaattcctgttatatgaattgtattatccaatgtttactaagcact
catgagctatctcagatctttttaaacaattcatacgaaaagcacatcaatttgaacagc
aaattaggttctaaaggtgtcttggcaaaatactttgctagacttgttcacacaatgtat
agagaaggttcatttaagagacctttggaaaagaacaaacccatccaacctattcaattc
aaaatggcatgcgggtcaataaattcattatttaaagacaacacccagcaagatagtcag
gaattttgtcaattcttattagatggtttacatgaagacttaaatcaatgtggggcaaac
ccgccattaaaagaattatctgaggatgctgaaaagatgagagaaaaattgtcaatgaga
atagcgtcttcaattgaatgggaaagatttttaaccaccgacttcagcgttatcgtagat
ttattccaaggacaatatgcttcacaacttaaatgtaaagtttgtggttgcacttcgact
acatatcaaaccttttccgttctttcggttccagtgcctcatgtgtcatcatgtcatata
cttgattgctttaatgagtttacaaaggtcgagaaattaggaactgatgaactttggtcg
tgcccaacttgtaagaagaaacaaccatctaccaaaaaattaacaattacaagattgcca
agaaatttgattatccatttgaagagatttgataacatgatgaacaagaacaatgttttt
gttaagtatccatttcttttggatcttactccttactgggcaaatgactttgatggcaga
ctaccacctggcgtcaccgatgaattaccaacaagaggtcaagtacctccttttagatat
aaattaaatgcagtagcatctcatgtcggaagcttatatggtggccattatactgcatat
gtaaataaaggaattaatagaggatggcactattttgatgatactagctatcgcccaatt
aaaaacgagacggaatgtatcactccaaatgcatatgtgttattttaccatagagtttat
ggtgtttaa

DBGET integrated database retrieval system