KEGG   Vanderwaltozyma polyspora: Kpol_1033p1Help
Entry
Kpol_1033p1       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:vpo04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 276 aa AA seqDB search
MEKIERHTFKVFNQDFTVDKRFALIKEIGHGAYGVVCSARFTEAADDTTVAIKKVTNVFS
KTLLCKRSLRELKLLRHFRGHKNITCLYDLDIVFNNDGSFNGLYLYEELMECDMYQIIKS
GQSLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSEN
PVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVNQ
LNRILQVLGTPPDETLRRIGSKNVQDYIHQLGYIPK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatagaaaggcatacattcaaggtttttaatcaagactttacagtcgacaaa
aggtttgccttgatcaaagaaattggccatggtgcatatggtgtagtatgttcagctcgt
ttcactgaagctgctgatgacacaactgttgctataaagaaagttacaaatgttttctca
aagactttactttgtaaaagatctttgcgtgagttaaaattgttaagacatttcaggggt
cataagaatatcacatgtttgtatgatctggatattgttttcaataatgatggctctttc
aatggtctatatttgtatgaagaattgatggagtgtgatatgtatcagatcattaaatca
ggccagtctttgacagatgctcattatcaaagtttcatttaccaaatattatgtggtttg
aaatatattcactctgctgatgttttacatcgtgacttaaaacctggtaatttactagta
aatgctgattgtcagcttaaaatttgtgattttgggttagctagaggttattcggaaaac
cccgtagaaaacaatcaattcttaacagaatatgtggctacaagatggtaccgtgctcct
gaaattatgttaagttatcaaggttatacaaaagctatcgatatttggtcgactggttgt
attttggctgaatttttaggtggaaaaccgatctttaaaggtaaagattacgtcaaccaa
ctgaacagaattttacaagttttaggtacccctccagacgaaactttacgtagaattggt
tctaaaaatgttcaagattatattcatcaactaggatatatcccaaaa

DBGET integrated database retrieval system