KEGG   Vanderwaltozyma polyspora: Kpol_1033p50Help
Entry
Kpol_1033p50      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:vpo04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
MDIDTQEQQLQKQFEQQKYDEKQQLQHQQQQQHYFNAPNIQQSQQGQTSTNDYNQSLLFQ
RSSVSKGKYTLKDFQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQIEHTN
DERKILKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE
VILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEV
IATKPYNKSVDWWSLGILIYEMLAGYTPFYDTTPMKTYEKILHGKVNYPSFFHPDVIDLL
ARLITADLTRRLGNLQSGAEDIKSHAWFSEVVWSKLLAKDIVTPYEPPIQSEVGDSSLFD
QYPEEQLDYGIQGEDPYVQYFTDF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatattgatactcaggaacaacagttgcaaaaacaatttgagcaacagaaatacgac
gaaaaacaacagttgcaacatcaacagcagcaacagcactatttcaatgctccaaatatt
caacaatcgcaacaaggacaaacatccaccaatgattataatcaatctttattgtttcaa
cggtcttctgtatcaaagggtaagtacactttaaaagattttcaaataatgagaacctta
ggtaccggttcctttggtagagttcatttggttagatcggttcataataaaagatattat
gctattaaggtcttgaagaaacaacaaatttttaaaatgaaacaaattgaacatacaaat
gatgaaagaaaaattttaaaaatagtagagcatccattcttgattcgaatgtggggtact
ttccaagattctagaaatttgtttatggttatggattatattgaaggtggtgaattgttt
tcattattgagaaagtcacaaagatttccaaaccctgtagcaaagttttatgctgctgag
gtaatattagcgcttgattatttacattctcataatatcatttaccgtgatttaaaacca
gaaaatattttgctagaccggaatggtcatataaagattacagattttggttttgccaaa
gaagtctcgactgtcacctggaccttatgtggtactcctgattacattgccccagaagtc
atagcaaccaaaccttacaataaatcagttgattggtggtcattgggtatcttgatatat
gaaatgctagcagggtatacaccattctatgatactacaccaatgaaaacatacgaaaaa
attttacacggtaaagttaattatccatccttcttccatcctgatgtgatagatttatta
gcaagactgatcacagctgacttgacaaggagactgggtaatttgcagagtggagcagaa
gatataaaatcgcatgcatggttcagtgaagtagtttggtcaaaactacttgcaaaagat
atagtaactccatatgaacctccaattcaatcggaagtcggtgattcatctttattcgac
caatatccagaagaacaattagattatggtatacaaggagaagatccatacgttcaatac
tttacagatttttaa

DBGET integrated database retrieval system