KEGG   Vanderwaltozyma polyspora: Kpol_1033p50Help
Entry
Kpol_1033p50      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04113  Meiosis - yeast
vpo04138  Autophagy - yeast
vpo04213  Longevity regulating pathway - multiple species
Module
vpo_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    Kpol_1033p50
  Cell growth and death
   04113 Meiosis - yeast
    Kpol_1033p50
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Kpol_1033p50
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Kpol_1033p50
Protein kinases [BR:vpo01001]
 Serine/threonine kinases: AGC group
  PKA family
   Kpol_1033p50
Messenger RNA biogenesis [BR:vpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Kpol_1033p50
Chromosome and associated proteins [BR:vpo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Kpol_1033p50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 5545988
NCBI-ProteinID: XP_001645602
UniProt: A7TJ45
AA seq 384 aa AA seqDB search
MDIDTQEQQLQKQFEQQKYDEKQQLQHQQQQQHYFNAPNIQQSQQGQTSTNDYNQSLLFQ
RSSVSKGKYTLKDFQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQIEHTN
DERKILKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE
VILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEV
IATKPYNKSVDWWSLGILIYEMLAGYTPFYDTTPMKTYEKILHGKVNYPSFFHPDVIDLL
ARLITADLTRRLGNLQSGAEDIKSHAWFSEVVWSKLLAKDIVTPYEPPIQSEVGDSSLFD
QYPEEQLDYGIQGEDPYVQYFTDF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatattgatactcaggaacaacagttgcaaaaacaatttgagcaacagaaatacgac
gaaaaacaacagttgcaacatcaacagcagcaacagcactatttcaatgctccaaatatt
caacaatcgcaacaaggacaaacatccaccaatgattataatcaatctttattgtttcaa
cggtcttctgtatcaaagggtaagtacactttaaaagattttcaaataatgagaacctta
ggtaccggttcctttggtagagttcatttggttagatcggttcataataaaagatattat
gctattaaggtcttgaagaaacaacaaatttttaaaatgaaacaaattgaacatacaaat
gatgaaagaaaaattttaaaaatagtagagcatccattcttgattcgaatgtggggtact
ttccaagattctagaaatttgtttatggttatggattatattgaaggtggtgaattgttt
tcattattgagaaagtcacaaagatttccaaaccctgtagcaaagttttatgctgctgag
gtaatattagcgcttgattatttacattctcataatatcatttaccgtgatttaaaacca
gaaaatattttgctagaccggaatggtcatataaagattacagattttggttttgccaaa
gaagtctcgactgtcacctggaccttatgtggtactcctgattacattgccccagaagtc
atagcaaccaaaccttacaataaatcagttgattggtggtcattgggtatcttgatatat
gaaatgctagcagggtatacaccattctatgatactacaccaatgaaaacatacgaaaaa
attttacacggtaaagttaattatccatccttcttccatcctgatgtgatagatttatta
gcaagactgatcacagctgacttgacaaggagactgggtaatttgcagagtggagcagaa
gatataaaatcgcatgcatggttcagtgaagtagtttggtcaaaactacttgcaaaagat
atagtaactccatatgaacctccaattcaatcggaagtcggtgattcatctttattcgac
caatatccagaagaacaattagattatggtatacaaggagaagatccatacgttcaatac
tttacagatttttaa

DBGET integrated database retrieval system