KEGG   Vanderwaltozyma polyspora: Kpol_1033p62Help
Entry
Kpol_1033p62      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00010  Glycolysis / Gluconeogenesis
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_1033p62
Enzymes [BR:vpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Kpol_1033p62
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim DUF5505
Motif
Other DBs
NCBI-GeneID: 5546002
NCBI-ProteinID: XP_001645613
UniProt: A7TJ56
AA seq 296 aa AA seqDB search
MGIEETATQVILTHPENSSSSVSILKYGATIFSWKSNGEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNEDDELLKQLPQHGLARNSTWEFLGQVKSNPPTVQFGLSEEIANPELTKLW
PKSFSLILTVELGKDHLFTDIEIKNPSQTESFKFNWLFHTYLRVEDIEDTFVSNLAGMTT
YDQLLADSYVDKHPVVTFHEEVDKIYKNVDADRIIQVVNRGVPIHSVKRTNLPDAVVWNP
WTKKSGGMADFEPKNGYLNMVCVEPGHVHDFVTLAPGETWKASQKLYNGELKYQAI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgaagagactgctactcaagttattttaacacatcctgaaaacagctcatca
agtgtttcaattttgaaatatggtgcaactatattctcatggaaatctaatggtgaagaa
caattatggttatctacagctgctaaactggatggttcaaagccagttagaggtggtatt
ccgttagttttcccagtttttggtaaaaatgaagacgatgaattgttaaagcaattgcct
caacatggtttggcaagaaattctacttgggaatttttaggtcaagtcaagagtaatcca
ccaactgttcaatttggtttaagcgaagaaattgccaatcctgaattgacaaagttatgg
ccaaaaagtttttccttaatattaactgttgaattaggtaaagatcatttatttactgat
atcgaaattaaaaatccatctcaaacagaatcttttaaatttaactggttattccacact
tatttgagagttgaagatatagaagacacatttgtctctaatttagctggtatgaccact
tatgatcaattattagctgattcttatgttgataagcatcctgttgtaactttccatgaa
gaagttgataagatttataaaaacgttgatgctgaccgtatcatccaagttgttaacaga
ggtgttccaatccactctgtcaagagaaccaacctaccagatgccgtagtttggaatcca
tggaccaagaaatctggcggtatggctgatttcgaaccaaagaatggttacttgaatatg
gtttgcgttgaacctggtcatgttcatgatttcgttactttagcaccaggtgaaacttgg
aaagcttctcaaaagctgtacaacggtgaattgaaataccaagctatataa

DBGET integrated database retrieval system