KEGG   Vanderwaltozyma polyspora: Kpol_1036p1Help
Entry
Kpol_1036p1       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vpo01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vpo00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MPVLKQSQNSDNGNSNELVQSAPNLSDFNQIQSYLQKESEKIDEWWNDERWNGVKRIYSS
YEIAKRRGVMEKVDYQSSVMSRKLYKVLRNHFANGTVSKTFGALDPVQITQMSKYLDTIY
VSGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQLFHDRKQFEMRANASSKEELE
ALGKPTDYLTPIVADADAGHGGLTAVFKLTKMFIERGAAGIHIEDQTSTNKKCGHMAGRC
VIPVQEHINRLTTVRMCSDIMGSDLVLVARTDSEAATLISSTIDPRDHYFVVGATNPEMD
DDLSFADCMNQAIISGSSGNDLQVLENNWCEKAGLKLFHEAFADEVNKNPEIKNKQEIID
AFNSKVGPLTETSHREAKKLAKELIGYDIYFNWELPRVREGLYRYRGGTQCAVMRARAFA
PYADLVWMESNYPDFQQAVEFSEGVRAKFPNKMMAYNLSPSFNWQKAMPVDEQETFISRL
GEYGYCWQFITLAGLHTTALSTLKFTQEFMEEGMKAYANKVQQQEMDLGVDVLKHQTWSG
AEYIDGLLKLAQGGVSATAAMAKGVTEDQFKN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtattaaaacaatcccaaaattcagataatggcaattcaaatgaattggtccaa
agtgctccaaatttaagtgattttaaccaaatccaatcctatctacaaaaggaatctgaa
aaaattgacgagtggtggaacgatgaacgttggaatggtgtcaagagaatttattcttct
tatgaaatcgcaaaaagacgtggtgtaatggaaaaagtagattaccaatcctctgtaatg
tcaagaaaattatacaaagtattgagaaaccatttcgcaaatggtactgtctcaaaaact
tttggtgctttggatccagtccaaattactcaaatgtcaaaatatttagatactatttat
gtttctggctggcaatgttcttccactgcatccacttcaaatgaaccaggtccagattta
gcggattatccaatggacacagtcccaaataaggtagaacacttattcaaggcccaattg
ttccatgacagaaaacaatttgaaatgagagcaaatgcttcttcaaaggaagaattagaa
gctttgggcaaaccaactgattatttgactccaattgttgctgatgccgatgctggtcac
ggtggtttgactgcggtcttcaaattaacaaagatgttcatcgaacgtggtgccgctggt
attcatatcgaagatcaaacttcaacaaataaaaaatgtggtcatatggctggtagatgt
gttattccagttcaagaacacatcaacagattgaccactgtaagaatgtgttctgatatc
atgggttcagatttggttttggttgcaagaactgattctgaggccgctacattgattagc
tcaaccatcgatccaagagatcattactttgttgttggtgccaccaaccctgaaatggat
gatgatttaagttttgctgattgtatgaaccaagcaattatttctggaagttctggtaat
gacttgcaagtattggaaaataactggtgtgaaaaagctggtttgaaattattccatgaa
gcatttgctgatgaagttaataaaaacccagaaatcaaaaataaacaagaaatcattgat
gcattcaacagtaaggtcggcccattaactgaaacctcacacagagaagctaagaaatta
gctaaagaattaattggttatgatatctatttcaactgggaattaccaagagtaagagaa
ggtctataccgttacagaggtggtacccaatgtgctgtcatgagagcaagagcatttgct
ccatatgctgatttggtttggatggaatctaactacccagatttccaacaagcggtagaa
ttttctgaaggtgtaagagccaagttcccaaataagatgatggcttataacttgtcacca
tctttcaactggcaaaaagctatgcctgtcgatgaacaagaaactttcatttcaagattg
ggtgaatatggttactgttggcaattcattactttggctggtttacatactacagctcta
tcaactttgaagtttactcaagaatttatggaagaaggtatgaaagcttatgccaacaaa
gtccaacaacaagaaatggatttgggtgttgatgttctaaaacatcaaacatggtcaggt
gcagagtacattgatggtttattgaaattagcccaagggggtgttagtgcaacagctgct
atggctaaaggtgtcactgaagatcaatttaagaattaa

DBGET integrated database retrieval system